KEGG   Thermoanaerobacter wiegelii: Thewi_0417Help
Entry
Thewi_0417        CDS       T01607                                 

Definition
(GenBank) LemA family protein
  KO
K03744  LemA protein
Organism
twi  Thermoanaerobacter wiegelii
Brite
KEGG Orthology (KO) [BR:twi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Thewi_0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LemA DUF4837 OmpH DUF1043 Pilin_N ABC2_membrane_3 DUF327
Motif
Other DBs
NCBI-ProteinID: AEM77903
UniProt: G2MW15
Position
448493..449065
Genome map
AA seq 190 aa AA seqDB search
MKNPLIITLIVLAVIAVLVFGTIYGTYNQLVALDENVNSKWSQIDNQLQRRADLIPNLVE
TIKGYAAHEKEIFDSVNKAREKLLSANTVAEKAASNDELNTALGRLLAIAENYPNLKADA
NFRQLSDELAGTENRIAVARMDYNNAVQAYNTKIRSFPTSIIANMFGFKEREYFKTDEAA
KTVPKVDFSK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaatccgctaattattacattgattgttttggctgtaatagctgtattagtattt
ggaacaatttatggaacttataaccaattagtggcgttagatgaaaatgtaaatagtaaa
tggagtcagattgataatcagcttcaaagaagggctgatttaattcctaatttagtagag
actattaaaggatatgcagcacatgaaaaagagatttttgatagtgtaaataaagcgaga
gaaaaacttttaagtgccaacactgttgctgaaaaagcagcttcaaatgatgaattaaat
acagcattgggaaggcttcttgctattgcagaaaattatcctaatttaaaagctgatgca
aatttcaggcagttaagcgacgaactagcaggaactgaaaacagaatagctgtagcgaga
atggattataacaatgctgttcaagcttataacaccaagataaggtcttttccaacctct
atcatcgccaatatgtttgggtttaaggaaagagaatattttaaaacagatgaagcagca
aagactgtgcctaaagtagatttttccaaataa

DBGET integrated database retrieval system