KEGG   Thermoanaerobacter wiegelii: Thewi_0423Help
Entry
Thewi_0423        CDS       T01607                                 

Definition
(GenBank) Protein of unknown function DUF2250
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2250 HTH_20 TrmB HTH_24 Replic_Relax HTH_12 HTH_Crp_2 FaeA MarR_2 DUF4423 HTH_45 SelB-wing_1 HTH_IclR MarR HTH_AsnC-type Rrf2
Motif
Other DBs
NCBI-ProteinID: AEM77909
UniProt: G2MW21
Position
454352..454678
Genome map
AA seq 108 aa AA seqDB search
MPLNNDQDEFLDLTILTYLKKLGPEYAKLLARRLGLSLEESRKRLQSLEERGLIKRVERR
IVKYYHRRRKSVKHRNHTYYELTREGELFLRQARKEIDINFDIEYPNR
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgccactcaacaatgaccaagatgaatttcttgatttaacaatcctcacctacctcaaa
aagcttgggccggaatatgcgaaacttttggcgaggcgcctaggtttatcattagaagaa
agcagaaagcgacttcaaagtttggaggagagaggactaatcaagcgagtggaaagaaga
atagttaaatattaccatcgacgacgaaaaagtgttaagcatcgcaatcacacatattat
gagctcactagggaaggggaactttttctaagacaggcgaggaaggaaattgatattaat
tttgacatcgaataccctaacagataa

DBGET integrated database retrieval system