KEGG   Thermoanaerobacter wiegelii: Thewi_0425Help
Entry
Thewi_0425        CDS       T01607                                 

Definition
(GenBank) SUF system FeS assembly protein, NifU family
  KO
K04488  nitrogen fixation protein NifU and related proteins
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NifU_N Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AEM77911
UniProt: G2MW23
Position
456075..456488
Genome map
AA seq 137 aa AA seqDB search
MSDLNQLYSEVIMEHYENSPHEKELKDATHKERGYNPLCGDNITLYLKMNGDIIEDASFT
GHGCAISQASTSMMIDLIKGKDKKEALRLVQQFIDMMHKKDVNLDELGDAQVLQGVSDFP
ARVKCALLAWKTLQEIL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatttgaatcagctttattctgaggttataatggaacattacgaaaactctccc
catgaaaaagaacttaaagatgctacccacaaagaaagaggttacaatcctctttgcggc
gacaatattactctttatttaaaaatgaatggtgacattatagaagatgcttctttcacg
ggccatgggtgtgccataagccaagcctcaacctctatgatgatagaccttataaaaggg
aaagacaaaaaagaagctttaaggcttgtgcaacaatttatagacatgatgcacaaaaaa
gatgtaaatcttgatgaattaggtgatgctcaagtactgcagggagtatctgactttcct
gcccgcgtaaaatgtgcattactggcatggaaaacgctccaggaaattttgtaa

DBGET integrated database retrieval system