KEGG   Thermoanaerobacter wiegelii: Thewi_0430Help
Entry
Thewi_0430        CDS       T01607                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K02015  iron complex transport system permease protein
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi02010  ABC transporters
Module
twi_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:twi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Thewi_0430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:twi02000]
    Thewi_0430
Transporters [BR:twi02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Thewi_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-ProteinID: AEM77916
UniProt: G2MW28
Position
460769..461761
Genome map
AA seq 330 aa AA seqDB search
MGVKKGIYFGTAFSLLVFTMILSISAGAVKIPLQEILNVFLGGGSETSRTIILNLRLPRA
IESAIVGMGLSVVGTFFQGLLRNPMADPYVLGVSSGAAFGATIAIILGLGIFGLSFMAFI
TSLMTVFFVYTISKTGTRVSMTTMLLAGIAISAFMSAIISLMMLLNHDEFSRIVFWTMGG
FSLINWNSVVFTTPIIVIGSFVMYVFSRDVNAILTGEEVAEHLGVNTELVKKIILITGSL
VTATAVSVGGIIGFVGLIVPHISRLIVGPDNRILVPFSAISGAIFLTFADLLARIILKPM
EIPIGIITAAFGGPFFLYLLIKSKQKSEGM
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgggagtaaaaaaagggatatattttggtacagccttttcactgcttgtctttaccatg
attttatcaatttctgcaggggcggtaaaaatacccctgcaggagattttaaatgttttt
ttgggcggtggcagtgaaacctctaggacaataatccttaatttaagacttccaagagct
attgaatctgcgattgtaggtatgggactttctgttgttgggacattttttcaagggctt
ttgagaaatccaatggcagacccttatgtattgggtgtatcatcaggagcggcttttgga
gctactattgcgataatattaggacttggaatatttggacttagttttatggcatttatt
acttctttaatgactgtatttttcgtatacactatttctaaaactggcacaagagtatcc
atgaccacaatgttattggcaggtatagctataagtgcttttatgtctgcaattatctct
ctcatgatgcttttaaaccatgatgagttttctcgaattgttttttggactatgggagga
tttagcctcataaattggaatagtgtggtctttactactcctataatagtaattggctct
tttgtgatgtatgtattttcaagggatgtaaatgcgatattgacaggagaagaagttgcc
gaacatttaggtgtcaacacagaattagtcaagaaaataattcttattacagggtctttg
gtgactgcaactgctgtgtcagttggtggaattataggttttgtgggacttattgtgcct
catatatcaaggcttattgtaggacctgacaatagaattcttgtaccttttagtgctata
tcaggagcgatatttttaacttttgcagacttattagcacgaattattttaaagccaatg
gaaattccaattgggataattacagcagcatttggaggaccattctttttatatctgtta
ataaagagcaaacaaaaaagtgaaggaatgtga

DBGET integrated database retrieval system