KEGG   Thermoanaerobacter wiegelii: Thewi_0445Help
Entry
Thewi_0445        CDS       T01607                                 

Definition
(GenBank) Glutamyl-tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00860  Porphyrin and chlorophyll metabolism
twi01100  Metabolic pathways
twi01110  Biosynthesis of secondary metabolites
twi01120  Microbial metabolism in diverse environments
Module
twi_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:twi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thewi_0445
Enzymes [BR:twi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     Thewi_0445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlutR_N Shikimate_DH GlutR_dimer NAD_binding_2 NAD_binding_7 F420_oxidored 2-Hacid_dh_C IlvN AdoHcyase_NAD AlaDh_PNT_C Pyr_redox_3 ELFV_dehydrog THF_DHG_CYH_C ThiF
Motif
Other DBs
NCBI-ProteinID: AEM77926
UniProt: G2MW38
Position
473064..474251
Genome map
AA seq 395 aa AA seqDB search
MDINNIKMVGVDKDTPLELREKVSFKDIGEALIKLKELGLEEVVILSTCHRSEIYFYSQK
ISTDEVKDFFINYFGLKEDFIKYLRQIYGLDAVEHIFRVACGLESMVVGEDQILSQVKEA
IDTAQTFNSSGKIFFKLFRDAVTLGKKARTDTGIKDLALSISYIAVKFVQEVFKDIKGKK
AFVIGLGEMGQNAMKNLLDKGADVFVTNRTFSKAIELKEQIPQINIVPYEEKYLHIATSD
IVISATNAPHYTVNYDKFKKIYDGRKICMVDIALPRDIDPRIGQIEGVSLYTIDDLKKTA
EENKKERLSLIPVIEKMVKEEVNKFEKWYKTLEIEPYIKEVSRYANEVCNTEFQRIINKL
TDVSEKDKENIKIALKRVANKMANKMIAYLKENAY
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtggacataaataatattaaaatggtgggagtagataaggatactcctttagaattgaga
gaaaaagtttcttttaaagatattggagaggcattaataaaattaaaagagttgggactg
gaagaggttgtaatactttccacctgtcacagaagtgaaatttacttctattcacaaaaa
atatccacggatgaagtaaaagattttttcataaattactttggcttaaaagaagatttc
ataaaatatttaaggcaaatttacggacttgatgcagtggaacacatttttagagttgcc
tgtggacttgaatctatggtagtaggtgaagaccaaatattgtcacaggtgaaggaggct
atagataccgcacagactttcaactcttccggaaagatattttttaaactctttagggat
gcagtaactcttgggaaaaaagctcgtacagatacgggtataaaagatctggctttgtct
ataagctatattgcagttaaatttgttcaagaagtatttaaggatataaaaggcaaaaag
gcttttgtgataggtcttggcgagatggggcaaaatgctatgaaaaatcttttagataaa
ggtgctgatgtatttgttacaaacaggactttttcaaaagctattgaattaaaggagcaa
attccacagataaatattgtaccttatgaagagaagtacctgcacattgccaccagtgat
attgtaataagtgctacaaatgctcctcactacacagtaaattatgataagtttaaaaaa
atatacgacggcagaaaaatttgtatggtggatatagctcttcctagggatatagacccg
agaattggacaaatagaaggagtaagtctttatactattgacgatctaaaaaagacagcg
gaggaaaacaaaaaagagaggctttcacttattcccgttattgaaaaaatggtgaaagag
gaagtgaataaatttgaaaaatggtacaaaacacttgaaatagagccttatataaaagaa
gtaagtagatatgccaatgaagtttgtaacacagaatttcaaagaattataaataaattg
actgacgtatctgaaaaagacaaggaaaatataaaaatcgctttaaaaagagttgcaaat
aaaatggctaataaaatgatagcgtaccttaaagaaaacgcctattaa

DBGET integrated database retrieval system