KEGG   Thermoanaerobacter wiegelii: Thewi_0472Help
Entry
Thewi_0472        CDS       T01607                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_4 FR47 Acetyltransf_CG Acetyltransf_3 Acetyltransf_15 DUF3749 SCP2_2 6PF2K
Motif
Other DBs
NCBI-ProteinID: AEM77946
UniProt: G2MW58
Position
494164..494640
Genome map
AA seq 158 aa AA seqDB search
MGLKIREAIISDYENLLLLVKEVHEIHYKARPDYYKDTDIPLDKEDFINKLSHTEYKIMV
AENENDEIAGYIIYKIKKIEEHPLLVDRVVVYIEDLCVAGRFKRKGIGKKLLESAIEYGK
EINASSIELTVWAFNEEAIKFYESLSFKPQSIKMEMIL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgggattaaaaattagagaagctattatttcggactatgaaaatttattattactagtg
aaggaagtgcatgagattcattataaagctaggccagattattacaaagataccgatatt
ccactggacaaagaagattttataaataagttgtctcacacagagtataaaattatggtt
gcagaaaatgaaaacgatgagatagcagggtatataatttataaaataaaaaagattgaa
gagcatccgcttcttgttgacagagtagtagtatatatagaagatttatgcgtagcagga
agatttaaaagaaaaggtattggaaagaaacttttagaaagtgctattgaatatgggaaa
gaaattaatgcttcttcaattgaattgactgtatgggcttttaatgaagaagcaataaaa
ttttatgaatccctgtctttcaagcctcaaagtataaaaatggaaatgattttataa

DBGET integrated database retrieval system