KEGG   Thermoanaerobacter wiegelii: Thewi_0502Help
Entry
Thewi_0502        CDS       T01607                                 

Definition
(GenBank) metal dependent phosphohydrolase
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD HD_5 HDOD
Motif
Other DBs
NCBI-ProteinID: AEM77966
UniProt: G2MW78
Position
520142..520741
Genome map
AA seq 199 aa AA seqDB search
MEVYNYSEYYLIKHLMTSLKHYHYITYLHSIRVAKLTYLVSKKLGLPKEEQIYNCKGGLL
HDIGKVLVPVTILDKPAPLTELEYEFVKIHSSYGSEMLKIFPSLKDLVPGLLYHHERLDG
SGYPFGVSIIPLSAQIIGICDSFDAMTTKRPYNEKRLKSIHEAIFELKTQPQKYNYKIVE
ALEEVLWEKKGDQQHFISI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtatacaattacagcgagtattatcttataaagcatttaatgacgagtttgaaa
cattatcactatataacttatttacacagtataagagttgcgaaacttacttatttagtt
tctaaaaaattaggattacccaaagaggagcaaatttataactgtaaggggggattatta
cacgatattggcaaggtattagtacctgtcaccattcttgacaagccagctccgcttaca
gagttggaatacgagtttgtgaagatacattcaagttatggctcggaaatgttgaaaatt
tttccttcattgaaggatttggtcccagggttactttaccatcatgaaaggctagatggt
tctggctatccttttggtgtcagtattattcctttaagtgctcaaataataggaatttgt
gattcttttgatgcaatgactacaaaaaggccttataatgaaaagaggttaaaaagtata
cacgaggcaatatttgaattaaaaacccaaccacaaaaatataattacaaaatcgtagaa
gcactggaagaagtcttgtgggaaaaaaagggggatcaacaacactttatttctatataa

DBGET integrated database retrieval system