KEGG   Thermoanaerobacter wiegelii: Thewi_0505Help
Entry
Thewi_0505        CDS       T01607                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer with Cache sensor
  KO
K03406  methyl-accepting chemotaxis protein
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi02020  Two-component system
twi02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:twi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Thewi_0505
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Thewi_0505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:twi02035]
    Thewi_0505
Bacterial motility proteins [BR:twi02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Thewi_0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_2 MCPsignal dCache_2 Cache_3-Cache_2 HAMP Arfaptin BLOC1_2 Collagen_mid T7SS_ESX_EspC DUF2540
Motif
Other DBs
NCBI-ProteinID: AEM77967
UniProt: G2MQR8
Position
521223..522986
Genome map
AA seq 587 aa AA seqDB search
MKKLKKVGTKSIKSTLVLMFIAVTLISMSVLGFAAYNVSKKALLNLGETALKNKVNMGIA
FMEALEEQVQAGKLTREEAQEIFKSKMLNPKKEDGKTRGQNDKLELNIGAYMYAINSQGI
EMMHPYKEGEDISEVVDPKGNNIVKLIIEEGRNPKNNGIIHFYWQNPGEKKMRPKTNAVG
YFAPWDWFVNVGAYDEDFYRPVKTVLNVIIIISIINLIVGSMLIIWFLNRKLNPLNELSK
TMEEGANGNLNVNIDIKSKDEVGILANSFNTMIEGIKKLVFDIKSISESVNHSAENLAVA
SEQAAQATQDVAKAIEEIAQGASSQAKEAEESATATVVLGQLIDNSLKNAEDINHEIENV
NMVSSEGLVTIKELIEKTKHTIEANNNVKESTNYLLEKSTEISKIVETITGIADQTNLLS
LNAAIEAARAGEAGRGFAVVADEVRKLAEQSSQAARNIANLISEIQNTINNTYKTVEDST
KSIEEQSNVVNTTKDVFEGIIHAVNFIVEKIDNLNKSLKEIESHKNKIVDSIQNIAAVSE
ESAASAEEVSATSQEQSAIVEEMASTANELKNYANTLIEAIKQFKVE
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgaaaaaagtaggtacaaaaagtattaaatcaacattagttttaatgttc
attgcagtaactttaataagtatgtctgttttaggttttgctgcttataatgtatctaaa
aaggcacttttaaatcttggagaaaccgcactaaaaaataaagtaaatatgggaattgct
ttcatggaagcattagaagaacaagttcaagcgggtaaactaacaagagaagaagcacaa
gaaatttttaaatctaagatgttaaatcctaaaaaggaagatggaaaaaccagaggtcaa
aatgataaactagaactaaatataggagcttatatgtatgctataaatagtcaaggaata
gaaatgatgcatccatataaagaaggagaagatatatccgaagtagtagaccctaaaggt
aataatatagtaaagcttattattgaagaaggtaggaatcctaaaaataatggtattata
catttttattggcagaatcctggcgagaaaaaaatgcgtcctaaaactaatgcagttggg
tattttgcgccctgggattggtttgtaaatgttggtgcttatgatgaagacttttataga
ccagtaaaaacagttcttaatgtaataattataatatcaataataaatttaattgttggt
tctatgcttattatttggttccttaatagaaaacttaatcctcttaatgaactatcaaaa
acaatggaagagggagcaaatggtaatttgaatgtaaatattgatattaaatcaaaagat
gaagttggaatactggcaaacagcttcaacacaatgatagaaggaataaagaaacttgtt
tttgacataaagagcatatcagaatctgtaaatcattctgcagagaatttagcagtagca
tcagagcaggcagctcaagccacgcaggatgttgcaaaagccattgaagaaatcgcacaa
ggagcttccagccaagcaaaagaggcagaggagagtgctacagcgactgtagtacttggg
caactaatagataactcattaaaaaatgcagaagacataaaccatgaaatagagaatgta
aacatggtatcaagtgaaggacttgtaacaataaaagagctaatagagaagacaaaacac
acaatagaagcaaataacaatgtaaaagaatccacaaattatcttttagaaaaatctacg
gaaataagcaagattgtagagacgataacaggcatagcagaccagacaaatcttttatca
ctaaacgcggcaatagaggcagcgagagcaggagaagcaggaagaggctttgcagttgta
gcagatgaagtgaggaaattggcagaacagtcctcacaggcagcgagaaacatagcaaac
ttaatatctgaaatacaaaacactattaacaatacctacaaaacagtagaagactcaaca
aaatcgatagaagagcaaagcaatgtagtcaatactacaaaagatgtgtttgaaggaata
attcatgcagtgaatttcatagtagaaaaaattgataatcttaataaatctttaaaggag
atagaatctcacaagaacaaaatagttgattcaatacagaacatagcggctgtatcagaa
gagtcagcggcatcagcggaagaagtatccgcaacatcacaagaacagtcggcaattgtg
gaagagatggcatcaacagcaaatgaacttaagaattatgccaatacgcttattgaggca
attaaacaatttaaagttgagtaa

DBGET integrated database retrieval system