KEGG   Thermoanaerobacter wiegelii: Thewi_0510Help
Entry
Thewi_0510        CDS       T01607                                 

Definition
(GenBank) protein of unknown function DUF86
Organism
twi  Thermoanaerobacter wiegelii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF86 NTase_sub_bind
Motif
Other DBs
NCBI-ProteinID: AEM77972
UniProt: G2MQS3
Position
527421..527849
Genome map
AA seq 142 aa AA seqDB search
MINRQLIIERLTLIDGYLKELRALASIDKNSFLSDKRNAAAAESFLRRTLEAIFDIGRHI
LAKTGNIDLSTEYKSIARGLGEYGYVSPELSDKLVQMAGYRNRMVHLYNLVTEEELYEII
TSELTDIEEFISDIKNKVLEVK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgataaatcgtcagttaataatagaaagacttacgcttattgatggctatttaaaagaa
ttaagagccttagcttctattgataagaattcttttttaagtgacaaaagaaatgcagca
gcagctgaaagttttttaaggcgtactctcgaggcaatatttgatataggcaggcacatt
ttagctaaaacagggaatattgatttatcaaccgaatataaatcaattgcaagaggatta
ggagagtatggatatgtaagtccagaattaagcgataagttagtacaaatggctggatat
agaaatcgcatggtccatttatataatctggtaacagaggaagagctgtatgagattatt
acttcggaacttactgatattgaagagttcatatctgacataaaaaataaagtgttagaa
gtaaaataa

DBGET integrated database retrieval system