KEGG   Thermoanaerobacter wiegelii: Thewi_0622Help
Entry
Thewi_0622        CDS       T01607                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00071  Fatty acid degradation
twi00280  Valine, leucine and isoleucine degradation
twi00310  Lysine degradation
twi00362  Benzoate degradation
twi00380  Tryptophan metabolism
twi00620  Pyruvate metabolism
twi00630  Glyoxylate and dicarboxylate metabolism
twi00640  Propanoate metabolism
twi00650  Butanoate metabolism
twi00900  Terpenoid backbone biosynthesis
twi01100  Metabolic pathways
twi01110  Biosynthesis of secondary metabolites
twi01120  Microbial metabolism in diverse environments
twi01130  Biosynthesis of antibiotics
twi01200  Carbon metabolism
twi01212  Fatty acid metabolism
twi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:twi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Thewi_0622
   00630 Glyoxylate and dicarboxylate metabolism
    Thewi_0622
   00640 Propanoate metabolism
    Thewi_0622
   00650 Butanoate metabolism
    Thewi_0622
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Thewi_0622
   00072 Synthesis and degradation of ketone bodies
    Thewi_0622
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Thewi_0622
   00310 Lysine degradation
    Thewi_0622
   00380 Tryptophan metabolism
    Thewi_0622
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thewi_0622
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Thewi_0622
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Thewi_0622
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:twi04147]
    Thewi_0622
Enzymes [BR:twi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Thewi_0622
Exosome [BR:twi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thewi_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEM78079
UniProt: G2MS45
Position
644322..645500
Genome map
AA seq 392 aa AA seqDB search
MREVVIVSGARTAIGKFGGSLAGIPVVDLGAIVIKEALKRANIAPEQVDEVLMGNVIQAG
LGQNPARQSAVKAGIPVEVTSATINMVCGSGLRTVAMAAQAIMTGDAEIVVAGGMENMSR
GPYVLNEARFGYRMNDGKIVDAMVYDGLIDVFNQYHMGITAENVAERYGITREEQDEFAL
RSQKLAEAAITSGRFNDEIVPVLIPQKKGDPIEFKTDEHYRPGTTLEALSKLKPAFKPNG
TVTAGNASGINDGAAAVVVMSKDKAKELGITPLATIKSYAYAGVDPSVMGLGPIYSTRKA
LDKAGLKIEDIDLIEANEAFAAQALAVAKELNFDMDKVNVNGGAIALGHPIGASGARILV
TLLYEMKKRGSHLGLATLCIGGGMGISMIIEM
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagttgtaattgtaagtggtgcgagaactgcaataggaaaatttggaggtagt
ttggccggtattcctgttgtagacttaggagcaattgttataaaagaggctttgaaaagg
gcaaacattgctcctgaacaagtggatgaagtgcttatgggaaatgtaatacaagcagga
ctaggacaaaatccagcaaggcagtcggcagtgaaagcaggaattccagttgaagtaaca
tctgcaacaattaatatggtttgtggatcaggacttagaactgtagcaatggcggcacag
gctattatgacaggagacgcagaaatagttgttgctggtggaatggaaaatatgtcaaga
ggaccttatgttcttaatgaagcacgattcggttatagaatgaatgacggtaaaatagtt
gatgctatggtatatgatggcttaatagatgtatttaatcaataccatatggggataaca
gctgaaaatgttgctgaaagatatggaattacaagggaagagcaagacgaatttgcgcta
agaagccaaaagcttgcagaagctgcgattacatcaggaaggtttaacgatgaaattgta
cctgttttaattcctcagaaaaaaggcgatcccatagaatttaaaacggatgaacattat
agacctggtacaacattagaggctctttctaaattaaaacctgcgtttaaaccgaatgga
acagttacagcaggaaatgcatctggtataaacgatggagcagctgctgtggttgttatg
tcaaaagacaaagcaaaagagttaggaattactccccttgctacaattaagtcttacgct
tatgcaggggttgacccaagcgttatgggattaggtcctatttattctacaaggaaggct
cttgataaagcaggcttaaaaattgaagacattgacctcatagaagctaatgaagctttt
gcagcccaagcgttagcagttgcaaaagaactcaattttgatatggataaagtaaacgtc
aacggtggtgcaatagctttaggccatcctattggtgcaagcggagctaggattttagtg
acactgctttatgaaatgaagaagagaggttcccatcttgggcttgcgacactttgcata
ggtggtggtatgggcatatcaatgattatagaaatgtaa

DBGET integrated database retrieval system