KEGG   Thermoanaerobacter wiegelii: Thewi_0859Help
Entry
Thewi_0859        CDS       T01607                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00010  Glycolysis / Gluconeogenesis
twi00030  Pentose phosphate pathway
twi00051  Fructose and mannose metabolism
twi00052  Galactose metabolism
twi00230  Purine metabolism
twi00500  Starch and sucrose metabolism
twi00520  Amino sugar and nucleotide sugar metabolism
twi00521  Streptomycin biosynthesis
twi01100  Metabolic pathways
twi01110  Biosynthesis of secondary metabolites
twi01120  Microbial metabolism in diverse environments
twi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thewi_0859
   00030 Pentose phosphate pathway
    Thewi_0859
   00051 Fructose and mannose metabolism
    Thewi_0859
   00052 Galactose metabolism
    Thewi_0859
   00500 Starch and sucrose metabolism
    Thewi_0859
   00520 Amino sugar and nucleotide sugar metabolism
    Thewi_0859
  Nucleotide metabolism
   00230 Purine metabolism
    Thewi_0859
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thewi_0859
Enzymes [BR:twi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Thewi_0859
    5.4.2.8  phosphomannomutase
     Thewi_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AEM78289
UniProt: G2MWB9
Position
894375..895742
Genome map
AA seq 455 aa AA seqDB search
MKLNENMFRMYDIRGVWGEDLTAETAEIIGKAFGTYVRQKGIKDVLVGRDNRLSSRPIRD
ALIKGLTSTGCDVLDVGVLTTPAFYYSNVLYNYQAGMMITASHNPPQFNGFKVMVGPSTI
YGDELKKLYYIAEKGEFEKGTGNVKYAYPINSYINMIKEKVKLGDRKLKVVVDCGNGTGS
YFYPDVIYNLGCEVYPLYCESDPTFPNHFPDPVKEENLKDLIEEVKRVKADLGIAFDGDG
DRIGVVDDKGNIIWGDMLMILYWREIMKKHPGADAIVEVKCSQALVEEIERLGGKPIFFK
TGHSLIKAKMKELGTVFTGEMSGHMFFADEYYGFDDAAYAAARLLRILSNTDKSLSELLA
DVPKYPATPEIRLECDDEKKFDVVKGVTEYFKEKGYDIIDVDGARVLFDEGWGLVRASNT
GPELIVRCEAKTEEKLEAIKKELSEALAKFGVKFK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaatgaaaacatgtttaggatgtatgatattagaggggtgtggggtgaagat
ttaactgctgagaccgcagaaataataggaaaggcttttggtacatatgtgagacaaaaa
ggaattaaggatgtgctggtaggcagagataatagattatcatcaaggcctatacgagat
gctttgattaaaggacttacttctacaggctgtgatgtattagatgtaggggttttgaca
actccagctttttactattctaatgtcctgtacaattatcaagcagggatgatgattact
gcaagccacaatccgccacaatttaatggtttcaaagttatggtaggaccttctactatt
tatggcgatgaacttaaaaaactatactatatagcagaaaaaggcgaatttgaaaaaggt
acagggaatgtgaagtatgcttatcctattaattcgtatattaacatgataaaagaaaag
gttaaattaggtgacagaaagcttaaagttgttgtcgattgtgggaatggcacaggttca
tatttttatcctgatgttatatataacttaggttgtgaagtatatcctctctattgtgaa
tctgatcctacatttccaaaccatttcccagatccagtaaaagaagaaaatttaaaagat
ttaattgaagaagtaaaaagagtgaaggctgatttgggtatagcttttgatggtgacggt
gatagaattggcgttgtggatgataaggggaatataatttggggagatatgttgatgatt
ctttattggagagaaataatgaaaaaacatcccggtgccgatgccattgtagaagtgaaa
tgttctcaggcattagtagaagaaattgagagattgggaggcaagcctatcttcttcaaa
acaggacattccctcataaaagcaaaaatgaaagaattaggtactgtgtttacaggagaa
atgtctggtcatatgttttttgcagatgagtactatggatttgatgatgcggcatatgct
gcggcaaggctacttagaatactctctaacacagataaatctttgtctgagcttttagct
gatgtccctaaatatcctgcaacacctgaaataaggttagaatgtgacgatgagaaaaaa
tttgatgtggtaaaaggtgtgactgagtactttaaagaaaaaggatacgacattatagat
gttgatggcgcaagagtgttgtttgacgaaggatggggactggttagagcttctaacaca
ggaccagagcttattgtgagatgtgaggcaaagacagaagagaaacttgaagcaattaaa
aaagagctttcagaagctttagctaaatttggtgtgaaatttaaataa

DBGET integrated database retrieval system