KEGG   Thermoanaerobacter wiegelii: Thewi_1187
Entry
Thewi_1187        CDS       T01607                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00472  D-Arginine and D-ornithine metabolism
twi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:twi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Thewi_1187
Enzymes [BR:twi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Thewi_1187
SSDB
Motif
Pfam: OAM_alpha DUF2067 Lys-AminoMut_A RTC
Other DBs
NCBI-ProteinID: AEM78610
UniProt: G2MT24
Position
1214615..1214989
AA seq 124 aa
MRREDDFETRSKHLKHMTDEELDAYFWKLAEKIVDPLIELAYYHTSPSIERSVLLRMGFS
SIEAKEIVNRIEERGLLPKGAGNIVLKVAERVKKDYLTAGKSIANGEYLEVLDDIAREAS
KNEA
NT seq 375 nt   +upstreamnt  +downstreamnt
atgagacgagaagatgattttgaaacaagaagcaaacacttaaagcacatgacagatgaa
gaattagacgcgtatttctggaaattggcagaaaaaattgtagatcctttgatagagttg
gcatattatcacacatctccatctattgagcgttctgtgcttttacgaatgggtttttct
agtattgaggcaaaggagattgtaaacagaattgaggaaagaggtcttttgccaaaagga
gcaggaaatattgtgttgaaagttgcagaaagggttaaaaaggattacctcactgctgga
aaatccatagctaatggagagtacttggaggtgcttgatgatatagcaagggaggctagt
aaaaatgaagcttga

DBGET integrated database retrieval system