KEGG   Thermoanaerobacter wiegelii: Thewi_1188
Entry
Thewi_1188        CDS       T01607                                 

Definition
(GenBank) cobalamin B12-binding domain protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00472  D-Arginine and D-ornithine metabolism
twi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:twi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Thewi_1188
Enzymes [BR:twi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Thewi_1188
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AEM78611
UniProt: G2MT25
Position
1214979..1217183
AA seq 734 aa
MKLEKDKKIDIEEILKDLDKYVPRRRGWHWREDVGKHKIGDFEYYQVSKPLKNSIPLPAA
KHFGNIDPQPDCVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHFDGLIEGTP
EGVGGVPISRKQIRATRKALDLIEDEVGRPINFHSYVSGIAGPEVAVMFAEEGVNGAHQD
PQYNVLYRNINMVRSFVDAAVAKKIMADANILQIDGAHNANATAKYGWKVMPELLVQHAI
NTLYSRKVGMKPENIALSTVPPNAPPTPSIRLDLPYAVALRQLFKDYKMRAQMNTKYIEH
DMREATVTHVLNLLISRLTSADIQSTITPDEGRNVPWHYNNINAINTAKQALIGMDGLKE
MVKLNFDGELGKKVRELKMRAILFMEEILEVGGYFKAVEEGFFVDSGYYPERNGDGIVRT
INGGIGAGTVYKRDKDYIAPVCSHFGYNNLPEGLNKPCDLIDGCTLCKHEKIHYIDELDE
NDNVENRLKETVEYRKGDKIKPEVEWAGDGIISMNLFLPVDERTAEYAAIKYAEKLGLTD
VVVLGKLPMHPAEGTYVEVRGRVQFSIDKNELEIPPEEEILSDEEIEEDIKRKPMKVVAA
TVGNDEHSVGLREILDIKHGGIEKYGIKFTYLGTSCPVEKLVDAAIEENADAILVSTIIT
HDDVHIKNMKKIHDLCIEKGIRDKVILVGGGTQITNDLAKSVGFDAGFGRGTKGNQVASF
LVKKRREKENEENN
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgaagcttgaaaaggataaaaaaatagatattgaagaaattttaaaggatttggacaaa
tatgtgcctaggagaagaggatggcactggagagaggatgtaggtaaacacaaaattggc
gattttgagtattatcaggtttcaaaaccacttaaaaacagtattcctttacctgctgca
aaacactttggaaacattgaccctcagccagattgtgtgataaccacagaaatagcttca
ggaaggtttgaagatgatataaggcgcatgagaatggcagcatggcatggagcagaccac
ataatggttattagaacgttaggacaaagccattttgatggactcattgaaggaacacct
gaaggtgtaggaggagttcctatttcgagaaaacaaataagagcgacgagaaaagcattg
gatttaattgaagatgaggtcggtaggcctataaactttcactcttatgtaagtgggata
gccggtcctgaagtagctgttatgttcgctgaagaaggggtaaatggtgcccatcaagac
cctcagtacaatgtcctttatagaaatataaacatggtaaggtcttttgtagatgcagca
gttgctaagaaaataatggcagatgctaatatacttcaaattgatggtgctcacaatgcc
aatgcaacagcaaaatatggatggaaagttatgcctgaacttttagttcagcacgctata
aatacactttattcgagaaaagtaggaatgaaaccagaaaacatagccttatctacagtg
ccaccaaatgctccaccaactccttccatacgtttggatttgccgtatgcagtagctttg
aggcagctttttaaagattataaaatgagagcgcaaatgaatacaaaatatattgagcac
gatatgagagaagcaactgtaacacatgtgcttaaccttttaatatctcgattgacctca
gcagatatacaaagtactattactcctgatgagggaagaaatgtcccatggcattacaac
aatatcaacgcgataaacactgctaaacaagcccttatcggcatggacggattaaaagag
atggtaaagctcaattttgatggagagttaggcaaaaaagtaagagaattaaagatgaga
gccattctctttatggaagaaattttagaagttggaggatactttaaggcagtagaagaa
ggcttctttgtggattcaggctattatccagagagaaatggagatggcattgtaagaact
ataaatggcggtattggcgccggtactgtttacaaaagagataaagactatattgcacca
gtatgctctcactttggatataacaatttgccagaagggcttaataaaccttgcgattta
atagatggatgtactctttgcaagcatgagaaaatccattatatagacgaattggatgag
aatgacaatgtagaaaatagattgaaagaaactgttgagtacagaaaaggagataaaata
aagccagaagttgaatgggcaggagacggcataataagcatgaacctatttttgcctgta
gatgaaaggactgctgaatacgcggctattaaatacgcagaaaagctggggcttactgat
gtagtcgttttaggtaaacttccaatgcatcctgcggagggaacgtacgtggaagtaaga
gggcgtgttcaattttctattgacaaaaatgaattagaaataccgccggaagaggaaata
ctttcagatgaggaaatagaagaagatattaagagaaagcctatgaaggtggttgctgca
actgtaggaaatgatgaacattctgtgggcttaagagagattttggacataaaacatggc
ggaattgaaaaatatggcataaaatttacttaccttggtacttcttgtcctgtagaaaag
ttagttgatgcagctatagaggaaaatgccgatgctatcttagtcagcactataataacc
catgacgatgtccatataaagaatatgaaaaaaattcacgacctttgtatagaaaaagga
ataagagataaagtaattttggtaggtggaggtacgcagattacaaacgaccttgctaaa
agtgttggctttgatgcgggatttggaagaggtacaaaaggaaatcaagtggcaagtttt
ttagttaaaaaaagaagggaaaaggaaaatgaggaaaacaattga

DBGET integrated database retrieval system