KEGG   Thermoanaerobacter wiegelii: Thewi_1226Help
Entry
Thewi_1226        CDS       T01607                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00330  Arginine and proline metabolism
twi00332  Carbapenem biosynthesis
twi01100  Metabolic pathways
twi01130  Biosynthesis of antibiotics
twi01230  Biosynthesis of amino acids
Module
twi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thewi_1226
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Thewi_1226
Enzymes [BR:twi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Thewi_1226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEM78649
UniProt: G2MV93
Position
1248649..1249767
Genome map
AA seq 372 aa AA seqDB search
MKIVVKVGTSTLTYENGKLNLEIMEKLVRQIANLLNRGEEVVLVTSGAIGAGMGKLNLKE
KPKTIPEKQSLAAIGQGLLIEIYEKFFNEYGKITAQVLLTKEDFSDRRRYLNVSYTLSNL
LKWGVVPIINENDTVTVDEIKIGDNDTLAALLASLVEADLLIILTDIDGLYNKDPRIYKE
AKIIEIVEEFSDELFKIAGSAGTKRGTGGMYTKIQAAKICWNSGVKMIIANGKIDNVLNR
IANGEKIGTTFLPMKNPINSRKIWIAFNAKVNGFLFIDEGAAKAIIKHGKSLLPSGVVKT
EGDYDVGDCVAVVDHQEKEIARGLINYSSEEVEKIKGCKTHEIEKVLGYKYYDEVIHRNN
LVILERGEKYGS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtagtaaaagttggtacaagcactttgacatatgaaaatggtaaattgaat
ttagaaataatggagaagttagtaaggcaaattgctaatttattaaacagaggagaggaa
gtagtattagtaacctctggggcaattggggcgggaatgggaaaattaaatttaaaggaa
aaacctaaaaccattccagaaaagcaatccctagcggctatagggcaagggcttttaatt
gagatttatgaaaagttttttaatgaatatggcaaaattactgcgcaagttcttttgact
aaggaagattttagcgatagaagaaggtatttaaatgtcagttataccttgtcaaacctg
ctcaaatggggcgttgtgccaataataaatgagaatgatacagtaactgttgatgaaatc
aaaattggagacaatgacactttagcggcgctgcttgctagtttagttgaggctgacctt
ttgataattttgactgacattgatggactttataataaagaccctcgaatttataaagag
gcaaaaattatagaaatcgtagaagagttttcagatgaattgtttaaaattgcgggtagt
gctgggacaaaaagaggaactgggggaatgtatacaaagattcaggcagcaaagatatgt
tggaattcaggagttaagatgattatagcgaatgggaaaattgacaatgtattaaatagg
atagcaaatggcgaaaaaattggcactacatttttgcctatgaaaaacccgataaatagc
aggaaaatttggattgcttttaatgcgaaagtgaacggatttctttttattgatgaagga
gcagcgaaagctattataaagcatgggaaaagtctattaccaagtggagttgtaaaaact
gaaggggattatgatgtaggagactgtgttgcagtggttgaccatcaagaaaaagagatt
gccagaggacttattaattattcttcagaagaagttgaaaagataaaaggttgtaaaact
catgaaatagaaaaggtattaggttataaatattatgatgaagtaatccataggaacaat
cttgtaatacttgaaagaggtgagaagtatggaagttga

DBGET integrated database retrieval system