KEGG   Thermoanaerobacter wiegelii: Thewi_1464Help
Entry
Thewi_1464        CDS       T01607                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00230  Purine metabolism
twi01100  Metabolic pathways
Module
twi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Thewi_1464
Enzymes [BR:twi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Thewi_1464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Thymidylate_kin AAA_33 ABC_tran MMR_HSR1 ADK Cytidylate_kin AAA_28 AAA RsgA_GTPase AAA_17 dNK AAA_22 Rad17 AAA_29 PPK2 RNA_helicase cobW AAA_16 TsaE APS_kinase T2SSE ATP-synt_ab Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AEM78886
UniProt: G2MR89
Position
complement(1462858..1463481)
Genome map
AA seq 207 aa AA seqDB search
MLSKKKKGLLIVLSGPSGAGKGTICKALMEKEKNLKLSISATTRQPRSGEIEGKNYFFKS
EEEFEKMIENDSFLEWAKVYGHYYGTPKDFVLKNLEEGNDVVLEIDIQGALKIKEKFPEG
VFIFILPPSMEELKNRIKKRGTETEEEIIKRFKSAYEELNYVSRYNYVVINDSVEEAVEK
IRAIIIAEKCRVDRNKDLYLEIKEGLA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgttgtcgaaaaagaaaaaagggttacttattgtgctttctgggccttcaggggcagga
aaaggaactatatgcaaagccttgatggaaaaagagaaaaatttaaaattgagtatatct
gccaccacccgtcagccaagaagcggggaaatagaagggaaaaactatttttttaaatcg
gaagaggaatttgagaaaatgatagaaaatgattcttttttagaatgggcaaaggtatat
ggccactactacggtacaccaaaggatttcgtgttaaaaaatttagaagaaggaaatgat
gtagttttagagatagatattcaaggagctttaaaaataaaagagaagtttccagaagga
gtgtttattttcatattgcctccttcaatggaagaattaaaaaataggattaaaaaacgg
gggacagagacagaagaggagataataaaaagatttaaaagtgcttatgaggaattaaac
tatgtttccaggtacaattatgtagttataaatgatagtgtagaagaagcggttgaaaaa
attagagctataattattgcagagaaatgcagagttgatagaaataaggatttgtactta
gaaatcaaggaggggttggcatga

DBGET integrated database retrieval system