KEGG   Thermoanaerobacter wiegelii: Thewi_1627Help
Entry
Thewi_1627        CDS       T01607                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00010  Glycolysis / Gluconeogenesis
twi00020  Citrate cycle (TCA cycle)
twi00620  Pyruvate metabolism
twi01100  Metabolic pathways
twi01110  Biosynthesis of secondary metabolites
twi01120  Microbial metabolism in diverse environments
twi01130  Biosynthesis of antibiotics
twi01200  Carbon metabolism
Module
twi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thewi_1627
   00020 Citrate cycle (TCA cycle)
    Thewi_1627
   00620 Pyruvate metabolism
    Thewi_1627
Enzymes [BR:twi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Thewi_1627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 AATase Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AEM79030
UniProt: G2MTL6
Position
complement(1626126..1627274)
Genome map
AA seq 382 aa AA seqDB search
MPVNVVMPKLGLTMKEGRVDRWLKKVGDIVKKGEEIVEVSTDKITNVVESPADGILAKIL
VNEGEIVPVATPIGIITAEGEKLEEVEKSEEKFIKATPVAKRLAKENNIDLSLITGTGPG
GRITEEDVKKFISEQKVKTEEEGPKKEVAVIEGQALEKVERMPMDNIRKTISQRMKKSWS
EIPHVTEDIKVDVTELVNLRENLNHISDNKFTYTDLIAKACVIAIKKNPVVNWSIEGEYI
IKNSSINLGIAVALDNGLIVPVVKEADKKSLLELSKNIKELSERARNNKLTPDEIIGSTF
TITNLGMYEIDSFTPIINPPESAILGVNKIYKEPVVLDDNIVIRHIMKLSLSFDHRLIDG
ATAAKFLLDLKKTLENPVSLLI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaatgtagtgatgcctaaattgggacttacaatgaaagaaggcagagtagat
agatggcttaaaaaagttggtgatattgtaaaaaaaggagaagagattgtcgaggtttct
acagataagattaccaatgttgtagaatctccagcggatggaattttggcgaagatctta
gtaaatgaaggagaaattgtaccagtagctactcctattggaataattacagctgaaggg
gaaaagttagaagaagtagaaaaaagtgaggaaaagtttataaaagctactccagtagca
aaaaggttggcgaaggagaataacatagacctttctttaataactggaacaggaccaggt
ggaaggattactgaagaagacgtaaaaaagtttatttctgagcaaaaagtaaaaacagaa
gaagagggaccaaaaaaagaagtagcagtaatagaaggacaagcattggaaaaagttgaa
agaatgccaatggacaatattcgcaaaaccataagtcaaaggatgaaaaaaagctggtca
gaaattcctcatgttacagaagatattaaagtggatgtcacagaactggttaacttaaga
gaaaatttaaatcatattagcgataataaatttacttataccgatttaattgcaaaagca
tgtgtaatagctataaagaaaaatcctgtagttaactggtctatagaaggagaatatata
attaaaaatagcagtataaatctcggaattgcagtggctttagataatggtttaatagtt
cctgtagtgaaagaggcggacaaaaagagtctattagaattgtcaaaaaatataaaagaa
ttaagtgaaagagcgagaaataataagcttactccagacgaaataatcggaagtacattt
actatcactaaccttggaatgtatgaaatagatagtttcacgcctattataaatccgccc
gaaagtgctatattgggtgtcaacaaaatatataaagaaccagttgttctagacgacaat
attgttataaggcatattatgaaacttagcctttcttttgaccatcgattaatagatggg
gctaccgctgctaaatttttgcttgacttaaagaaaacattagagaatccagtatcttta
cttatttaa

DBGET integrated database retrieval system