KEGG   Thermoanaerobacter wiegelii: Thewi_1913Help
Entry
Thewi_1913        CDS       T01607                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00030  Pentose phosphate pathway
twi00480  Glutathione metabolism
twi01100  Metabolic pathways
twi01110  Biosynthesis of secondary metabolites
twi01120  Microbial metabolism in diverse environments
twi01130  Biosynthesis of antibiotics
twi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:twi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thewi_1913
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Thewi_1913
Enzymes [BR:twi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     Thewi_1913
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     Thewi_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored Shikimate_DH ApbA 3HCDH_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEM79295
UniProt: G2MXR5
Position
complement(1925909..1927315)
Genome map
AA seq 468 aa AA seqDB search
MNEIGLIGLAVMGQNLALNIARKGYSVSVFNRTPEKAQEFMQNKVKDEQIKPYYDIKSFV
ESLKRPRKIILMVKAGKPVDDVIQELLPYLDKGDLIIDGGNSYFKDTSRRIKELEEKGIL
YLGMGVSGGEAGALHGPSLMPGGTQDAYEMVKDVLLKIAAQTEAGPCCTYVGNDSAGHFV
KMVHNGIEYAIMQAIAEVYDVLRKVLKLSPEEIGEIFEKWNNGELNSFLMEISYKIMKYK
DKETGKYLVDLILDEAEQKGTGKWTSQTSLDLGIPTPSLNLAVEARSLSFFKEERVQLAK
RVTKIYPEIDIDKEKIIKDLENALLFSVFASFSQGLWVISEASKVFEYNIDLSEVLRIWK
GGCIIRAKILDFLRDIIKENKENVNLLNSEKALSFLMDKIDSIKYITNLAKDFYLPTLVL
NSSLDYFLSMIEENLPANLIQAQRDFFGAHTYRRIDKEGIFHTEWEAE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaataggtttaatcggcttagcagtaatgggacaaaatttggctttaaacatt
gccagaaagggctatagcgtatctgtatttaatagaacacctgaaaaagcacaagaattc
atgcaaaacaaagtaaaagatgaacaaattaagccttattatgacatcaaatcttttgtg
gaatctttaaaaagaccgagaaaaatcattctcatggttaaagcaggaaaacccgtagat
gatgtaattcaagagcttttgccttatcttgacaagggagacctaatcattgatggagga
aattcttattttaaagatacttcaaggagaattaaagaactagaagaaaaaggcatactc
tatttgggaatgggagtatcaggtggtgaagctggagctttacacggcccttcgttaatg
ccaggaggaacacaggatgcatatgaaatggttaaagatgttcttttaaaaattgcagct
caaacagaagcagggccatgctgtacatacgttggaaatgattcagctggacattttgtc
aaaatggtccacaatggaatagaatatgccataatgcaagcaatagctgaggtttacgat
gtacttcgaaaggtgttaaaactttctcccgaagagataggagagatatttgaaaaatgg
aataatggggagttaaactccttcctgatggagatttcttataaaataatgaagtacaaa
gacaaagaaacaggaaaatacctcgttgacctcatattagacgaagcagaacaaaaaggc
acaggcaagtggacttcccaaacttctttggatttaggaataccaactccctctttgaac
cttgcagtagaagcgagaagtttatctttctttaaagaggaaagagtacaattagctaaa
agagttacaaaaatatatcctgaaattgatatagataaagaaaaaataataaaggattta
gaaaatgcattactttttagtgtttttgcatctttttctcagggattatgggttatatct
gaagcttcaaaagtttttgagtataatattgacctttcagaagtattgcgtatttggaaa
ggtggctgcatcataagagcaaagattttagatttcttaagagacattattaaagaaaat
aaagaaaatgtaaatcttcttaacagtgaaaaggcgttatctttcctaatggataaaatt
gattcaataaaatatatcactaatttagcaaaagatttttaccttccaacacttgtactt
aattcttcattagattattttttgagcatgatagaagaaaacttgcctgctaatctaatc
caagctcaaagagatttcttcggtgctcacacttacagaagaatagacaaagagggaatt
ttccacactgaatgggaggcagaataa

DBGET integrated database retrieval system