KEGG   Thermoanaerobacter wiegelii: Thewi_2490Help
Entry
Thewi_2490        CDS       T01607                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
twi  Thermoanaerobacter wiegelii
Pathway
twi00010  Glycolysis / Gluconeogenesis
twi00260  Glycine, serine and threonine metabolism
twi00680  Methane metabolism
twi01100  Metabolic pathways
twi01110  Biosynthesis of secondary metabolites
twi01120  Microbial metabolism in diverse environments
twi01130  Biosynthesis of antibiotics
twi01200  Carbon metabolism
twi01230  Biosynthesis of amino acids
Module
twi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
twi_M00002  Glycolysis, core module involving three-carbon compounds
twi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:twi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thewi_2490
  Energy metabolism
   00680 Methane metabolism
    Thewi_2490
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thewi_2490
Enzymes [BR:twi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Thewi_2490
Membrane trafficking [BR:twi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Thewi_2490
Exosome [BR:twi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Thewi_2490
  Exosomal proteins of melanoma cells
   Thewi_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEM79818
UniProt: G2MTZ1
Position
complement(2510968..2511723)
Genome map
AA seq 251 aa AA seqDB search
MHKVVLLRHGESLWNMENRFTGWTDVDLSPRGIEEARESGKTLKAEGYTFDCAFTSVLKR
AIRTLWIVLDELDRMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEQQVKIWRRSADVR
PPALTKDDPRYAGFDPRYADLSEEEIPLTENLIDTINRVILYWESTIAPTIKSGKKVIIV
AHGNSLRGLVKYLDNLSNEEIMELNIPTGIPLVYELDDDLKPIRHYYLADEEKVKEKKEL
VAKQGKIQGNS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcataaggttgttttactgcggcatggagaaagcctgtggaatatggaaaatagattt
actggctggacggatgtggatctgtcaccgagaggtattgaagaggcaagagagagtggc
aaaactttaaaggcagaaggatacacttttgattgtgcttttacttctgtacttaaaagg
gctataagaactttgtggattgttcttgatgaattggacaggatgtggataccggtttac
aaatcatggaggcttaatgaaaggcattatggagcacttcaagggctcaataaagctgag
actgccaagaaatacggagaacagcaggtaaaaatatggagaaggtctgctgatgtaagg
cctcctgcattgacaaaagatgacccaaggtatgccggttttgaccctagatatgctgac
ctttctgaagaggaaattccccttactgaaaacttgattgatacaattaacagagttatt
ctctattgggaatctacaattgctccaactataaaatctggtaaaaaggtcattatagtc
gctcatggcaacagtttgagagggcttgtgaaataccttgacaatctttcaaatgaggag
ataatggagctaaacatccctacaggaattcccttagtttatgagcttgatgatgattta
aagcctataaggcattattatcttgccgatgaagagaaagtaaaagagaaaaaagaatta
gtagctaaacaagggaagattcaaggaaattcttaa

DBGET integrated database retrieval system