KEGG   Tropheryma whipplei TW08/27: TW196
Entry
TW196             CDS       T00117                                 

Gene name
coaD
Definition
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
tws00770  Pantothenate and CoA biosynthesis
tws01100  Metabolic pathways
Module
tws_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:tws00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TW196 (coaD)
Enzymes [BR:tws01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     TW196 (coaD)
SSDB
Motif
Pfam: CTP_transf_like
Other DBs
NCBI-ProteinID: CAD66873
UniProt: Q83I84
Position
234982..235512
AA seq 176 aa
MSNRIAVVPGTFDPVTRGHMDILTRTSRIFNTLYVLVANNPDKTPLLPMHDRVDLVGQAL
EEYGFPRSEPKCDSESDRNGPIVKIHRFEKGLLVDCCKQLGATVIVRGLISADAHREASM
AYANRNMSGIETVFILPDPPLSVVSSSMVRQLIALGGDISPYVPACVTRFFGTHSG
NT seq 531 nt   +upstreamnt  +downstreamnt
atgagtaacaggatagctgttgttccgggtacgtttgaccccgttacaagaggacacatg
gatatccttaccaggacttcaagaatttttaacacactctacgtcctggttgcaaataat
ccggataaaaccccacttttacctatgcatgaccgagttgatctggttggacaggctttg
gaagaatacggatttccccgcagtgagccaaaatgtgacagtgaatcagaccgtaatggg
ccaatagtcaagattcatcgctttgaaaaaggcctgttggttgattgctgtaaacagctt
ggcgcgaccgttattgtaaggggacttatttcggccgatgcacaccgagaggcgtcgatg
gcatatgccaatcggaatatgagtggcattgagactgtgtttattttacctgacccccca
ctgagcgttgtttcaagcagcatggtcaggcagcttatcgcacttggtggtgatatatcc
ccgtatgtaccggcttgtgtaacgcgtttttttgggacgcacagcggttag

DBGET integrated database retrieval system