KEGG   Tropheryma whipplei TW08/27: TW775Help
Entry
TW775             CDS       T00117                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tws  Tropheryma whipplei TW08/27
Pathway
tws00450  Selenocompound metabolism
tws00970  Aminoacyl-tRNA biosynthesis
tws01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tws00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TW775 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TW775 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tws01007]
    TW775 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tws03016]
    TW775 (metG)
Enzymes [BR:tws01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TW775 (metG)
Amino acid related enzymes [BR:tws01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TW775 (metG)
Transfer RNA biogenesis [BR:tws03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TW775 (metG)
 Prokaryotic type
   Other AARSs
    TW775 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Collar
Motif
Other DBs
NCBI-ProteinID: CAD67434
Position
872789..874540
Genome map
AA seq 583 aa AA seqDB search
MGFYITTPVFYVNDIPHIGHAYTLVVSDVFARWQRQSGKDTFFLSGTDEHGLKVLRAAEE
KNMTPQGWADLMVKTAWKPLLDLMHISNDDFVRTTESRHRERVKWFINRLRENQYIYSGQ
YSGYYCVSCEEFKTVSQSALPNDESVNGTLGKDPRTCSLPQGEEQNYFCEVHGCQLEHFT
EKNYFFRLSAFTDRLLDLYKKNPDFIEPKSAYNEVVQFVKNGVSDLSISRSSFTWGIEVP
WDEGHVVYVWFDALINYLTPVMSAKEELPIDGTTPGGAEFCTHSNLNTLESSIPGPGGSA
ESDRLSHTLSTSADNAALTSPFKKYWPASHIIGKDILRFHAVIWPAMLMAAGLPVPEKIF
AHGWLLVDGQKMSKSKLTGIKPQDLTDIFGVDAVRYYFLRQPVFGQDYSFSIESIAACYN
SELADGYGNLACRLSSMYTTYLNGRVIVPKIYSEEDESLLQACKDVSDRACKAIDELIPH
IAMAEIWSLAVRANTYTTRQQPWSLHKKQDDERLACVLYTALRALSTITILLSPIMPRIT
NKLWSAFGADGGVSQQNIRSAWGGKLSDKVSLIPPMFPKITIS
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgggtttttatattacaaccccggtgttttatgtaaatgatatcccccacataggtcat
gcgtatacattagtcgtttccgacgttttcgcgcgatggcaacgacagagcggaaaagac
acattttttctctcagggacagatgagcacggattgaaagtgctgcgtgctgcagaagag
aagaacatgaccccacagggatgggctgacctgatggtgaaaactgcctggaagccactc
ctcgacctaatgcacatttcaaatgatgattttgttcgcacaacggaatcaaggcatcgg
gagcgtgttaaatggtttataaatagactcagagaaaatcaatacatctacagcggacag
tacagcggatactattgtgtcagttgcgaagaattcaaaaccgtttcacaaagtgcgctg
cctaatgatgagtcagttaatggtacgctcggcaaagaccctcgtacatgcagcctgccg
cagggtgaagaacaaaattatttctgcgaagtgcacgggtgccagctcgagcacttcacc
gaaaagaactatttctttaggttgagcgcatttacagacagattacttgatctttataag
aaaaatccggactttatagaacccaagtctgcatataacgaagtagtacagtttgtaaag
aatggagtatctgacctctcgatatccaggtcaagttttacttggggcattgaggtgccc
tgggatgaggggcatgtggtctatgtttggttcgacgcattgattaactatctgacaccc
gtaatgtctgctaaggaagagcttccgatcgatggtaccacccctgggggtgcagaattt
tgcacacactccaatctgaatacacttgaatcaagtattccaggacctggaggatcagca
gaaagcgataggctatcccatactttaagtaccagtgccgacaatgcagctttgacctct
ccgttcaaaaaatactggccagctagccatataatcggtaaagacatattgagattccat
gccgtcatatggcctgctatgctgatggccgcaggactgcctgtgccggagaaaatattt
gctcatggttggctgttagttgacgggcagaagatgtcaaagtcaaagctgacaggtatt
aagccgcaagatttaacagatatttttggcgttgacgcagtgagatactattttttgaga
cagcctgtttttgggcaggattattcattcagcattgagagtattgcagcctgctacaac
tcggagctagcagatggctacgggaatcttgcctgtcgactaagttccatgtacaccaca
tatctgaatgggcgcgttatcgtgccaaagatttattctgaagaagacgaatctttgctg
caggcttgtaaagatgtgtcagatagggcctgtaaagcaatagatgaactcattccacac
atcgctatggctgaaatctggtctcttgcagtccgtgcaaatacatatacaaccaggcaa
caaccctggagtttacacaaaaagcaggatgatgagcgcctagcttgcgttctttacaca
gccctccgggctctttcaactatcacaattttactctcccccatcatgcctcggataacg
aacaagctatggagtgcatttggagcagatggcggtgttagtcagcaaaatatacgctcc
gcctggggcgggaaattgtcagacaaggtaagtctgatacctcctatgtttccaaaaatc
accatctcatag

DBGET integrated database retrieval system