KEGG   Thalassospira xiamenensis: TH3_03280Help
Entry
TH3_03280         CDS       T03639                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
txi  Thalassospira xiamenensis
Pathway
txi00260  Glycine, serine and threonine metabolism
txi01100  Metabolic pathways
txi01110  Biosynthesis of secondary metabolites
txi01120  Microbial metabolism in diverse environments
txi01130  Biosynthesis of antibiotics
txi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:txi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TH3_03280
Enzymes [BR:txi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     TH3_03280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AJD50782
UniProt: A0A0B4XWS9
Position
complement(725986..727011)
Genome map
AA seq 341 aa AA seqDB search
MNFASDNVSPLCPEILAALEHEASGNAPAYGADDTSQQLDAAFAELFDREVAVVPVATGT
AANCISLSALVSPFGGIVCHHEAHINEDESTGVAFFTGGAKLMPVDGPAAKLEADNLDAF
LASRVDRGVHSVAPECVAITQATELGTVYTADELAAIGAICKKRDLRLFMDGARFANAVA
HLGCHPADITWKAGVDAISFGATKNGAQAVDAIVLFDTSLRGKVEQARKRSGHLYSKHRY
LASQLLAYVKDDLWLRNARHANGAAKTLCDMLVSHGATLAHAADGNEIFANIPAELAQKM
RDAGALFYPWPSLGADIYRFVTAWNTDIAQISELNDRIARN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgcctctgacaatgtatcgcccctgtgcccggaaatcctggcagcgctggaa
catgaagccagcggcaatgcgcctgcttatggggcggatgacaccagccagcagcttgac
gcggcctttgccgagctgtttgacagggaagtggccgttgttccggtcgccaccggcacc
gcggcaaactgtatcagcctgtcggcactggtatcaccgtttggcgggatcgtttgccat
cacgaggcccatatcaacgaagatgaaagcacgggcgttgcattctttaccggtggcgca
aagctgatgccggttgatggcccggcggcaaagcttgaagccgacaatctggatgcgttt
ctggcaagccgggttgatcgcggggtgcattcggtggccccggaatgcgtggcgatcacg
caggcgaccgaactgggcacggtttacaccgccgatgagctcgcagccattggcgcgatt
tgcaaaaagcgtgaccttcggcttttcatggatggcgcacggtttgccaatgcggttgca
catctgggctgccacccggctgatatcacatggaaggccggcgttgatgcgatcagcttc
ggggcaaccaaaaacggtgcgcaggcggttgatgcgattgtcctgtttgatacgtcgctt
cgcggcaaggtcgagcaggcccgaaagcgcagcggacatctgtattccaagcatcgttat
ctggcctcgcagcttttggcctatgtgaaggatgatctttggctgcgcaatgcgcgccac
gccaacggggcggccaaaaccctttgtgacatgctggtgtcgcatggggcaacattggcg
catgccgctgatggcaacgagatttttgcgaatatccccgccgaactggcgcagaaaatg
cgcgatgccggggcgctgttttatccgtggccgtcattgggggcggatatttatcgattt
gtgacggcgtggaacacggatatcgcgcaaatcagtgagcttaatgatcgcattgcgcgc
aattga

DBGET integrated database retrieval system