KEGG   Thalassospira xiamenensis: TH3_08635Help
Entry
TH3_08635         CDS       T03639                                 

Definition
(GenBank) pseudouridylate synthase, 23S RNA-specific
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
txi  Thalassospira xiamenensis
Brite
KEGG Orthology (KO) [BR:txi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:txi03009]
    TH3_08635
Enzymes [BR:txi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     TH3_08635
Ribosome biogenesis [BR:txi03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    TH3_08635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AJD51845
UniProt: A0A0B4XYB4
Position
complement(1847279..1848280)
Genome map
AA seq 333 aa AA seqDB search
MNMESGLNTEHLEYIASPADEGARLDKVLATAWPEQSRSRIKSLIENGHLLLNDTPIAKM
SYKVKSGDRFALEIPPAVAADPIAEKIALDILYEDDDLLVINKPAGMVVHPAAGNESGTL
VNALLAHCGDSLSGIGGVKRPGIVHRLDKDTSGAMVVAKNDATHRALSTLFSEDKENIER
AYIAVVWGVPRQIEGVIEGNIGRSPRNRKKMAVLRNGGKPALTRYKVLAKRDDSLASLVE
CRLLTGRTHQIRVHMTHLGHSLICDPVYGRSKLTQKFSKHVHEVLTGFEKQALHARTLGF
LHPKTGNYVLTKAPLPEDLQELITCLDLPIGIV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggaaagcggcttgaacaccgaacatcttgaatatattgcctctcccgctgac
gagggagcgcggctcgacaaggttctggcaaccgcatggcccgagcaatcccgttcgcgc
atcaaaagcctgattgagaacggacatctgctgctgaatgacacgccgatcgccaagatg
tcatacaaggtaaaaagtggcgaccgctttgcgcttgaaatcccacccgcagtggcggcc
gacccaatcgccgaaaaaatcgcgctcgatatcctttatgaagacgacgatctgctggtg
atcaataaacccgccgggatggttgttcatcctgctgcgggcaatgaaagcggtacattg
gtcaatgctttgctggcccattgtggtgacagcctgtcggggatcggcggcgtgaagcgc
ccgggtatcgtgcaccggctcgacaaagacaccagtggggcaatggtggtcgcgaagaac
gatgcaacccatcgggcactttcgaccctgttttccgaggataaggaaaatatcgaacgc
gcttatatcgccgttgtttggggtgtcccgcgccaaatcgaaggcgtcatagagggaaat
atcggccgaagcccgcgcaatagaaagaagatggcggtacttcgaaatgggggaaaaccg
gcccttacgcgttacaaggttttggcaaaacgcgacgactcgttggcatctcttgttgaa
tgcaggcttttgactggcagaacacatcaaattcgcgttcacatgacccatcttggtcac
tcacttatatgtgatccagtttacggtagaagcaaacttacccagaagttcagcaagcat
gtgcacgaggtcctgacgggctttgaaaaacaggcgctacatgccagaacactgggattt
ttacacccaaaaacagggaattacgtcctcaccaaagcccccctcccggaagacctacag
gaactcatcacctgcctagacctacccattgggatagtttga

DBGET integrated database retrieval system