KEGG   Thalassospira xiamenensis: TH3_16740Help
Entry
TH3_16740         CDS       T03639                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
txi  Thalassospira xiamenensis
Pathway
txi00071  Fatty acid degradation
txi00072  Synthesis and degradation of ketone bodies
txi00280  Valine, leucine and isoleucine degradation
txi00310  Lysine degradation
txi00362  Benzoate degradation
txi00380  Tryptophan metabolism
txi00620  Pyruvate metabolism
txi00630  Glyoxylate and dicarboxylate metabolism
txi00640  Propanoate metabolism
txi00650  Butanoate metabolism
txi00900  Terpenoid backbone biosynthesis
txi01100  Metabolic pathways
txi01110  Biosynthesis of secondary metabolites
txi01120  Microbial metabolism in diverse environments
txi01130  Biosynthesis of antibiotics
txi01200  Carbon metabolism
txi01212  Fatty acid metabolism
txi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:txi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TH3_16740
   00630 Glyoxylate and dicarboxylate metabolism
    TH3_16740
   00640 Propanoate metabolism
    TH3_16740
   00650 Butanoate metabolism
    TH3_16740
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TH3_16740
   00072 Synthesis and degradation of ketone bodies
    TH3_16740
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TH3_16740
   00310 Lysine degradation
    TH3_16740
   00380 Tryptophan metabolism
    TH3_16740
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TH3_16740
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TH3_16740
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TH3_16740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:txi04147]
    TH3_16740
Enzymes [BR:txi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TH3_16740
Exosome [BR:txi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TH3_16740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJD53450
UniProt: A0A0B4Y2M5
Position
complement(3655499..3656671)
Genome map
AA seq 390 aa AA seqDB search
MTDVVIVGAARTPIGAFSGSLANTPAHELGAVAIKAALERSGVEADAVNEVIFGQVLTGG
AGQNPARQAAIAAGIPDSATAFVINQVCGSGLRTVALAAQQIMAGDAKIVVAGGQENMSM
SPHVANLRAGHKMGDVKFIDSMIKDGLWCAFNGYHMGNTAENIATKWQITREEQDAFATA
SQNKAEAAQKSGRFNDEIAPVTLSSRKGDVVFDADEYPRHGASLEGMAKLRPAFDKEGTV
TAGNASGINDGAAALIVMSADEAAKRGLTPLATIKSWATAGVDPAVMGSGPIPASRKALE
KAGWSVGDLDLIEANEAFAAQAIAVNRDMGWDTDKVNVNGGAIALGHPIGASGARVFTTL
LYEMQKRDAKKGLATLCIGGGMGVALCVER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtcgtaattgtgggtgccgcgcgcacaccgatcggcgcttttagcggttcg
ctggccaataccccagcacacgagcttggcgctgttgccatcaaggcggctctggaacgt
tccggtgtcgaggcggatgccgtaaacgaggttattttcggtcaggttctgaccggcgga
gccggacagaatccggcacgccaggcggccatcgcggcgggtatccccgatagtgccacc
gcctttgtcatcaatcaggtctgtggatcgggccttcgcaccgttgcccttgccgcccag
cagatcatggcgggtgacgccaaaatcgtcgttgccggtggtcaggaaaacatgtccatg
tcgccgcacgttgccaatctgcgtgccggtcacaagatgggtgatgtcaaattcatcgac
agcatgatcaaggatggcctgtggtgcgctttcaatggctatcacatgggcaacaccgcg
gaaaacattgccactaaatggcagatcacccgcgaagaacaggatgccttcgcgaccgcg
tcacaaaacaaggccgaagccgcccagaaatccggccgcttcaatgatgaaatcgcccct
gttaccctttcctcgcgcaagggcgatgtggtctttgatgccgatgaatatccgcgtcat
ggtgccagcctcgaaggcatggcgaaactacgcccggcctttgataaggaaggcacggta
accgccggtaacgcatcgggcatcaatgacggggccgctgccctgattgtcatgtcggct
gacgaggccgctaaacgcggcctgaccccgcttgctacgatcaaaagctgggcgaccgcc
ggggttgatccggctgttatgggctccggcccgatcccggcatcgcgcaaggcacttgaa
aaagccggttggtcggttggtgatcttgacctgatcgaagccaacgaagcctttgccgca
caggcaattgcggtgaaccgtgacatgggctgggataccgacaaggttaacgtcaatggc
ggggccattgcccttggccatccgattggcgcatcgggcgcacgtgtctttaccaccctg
ctgtacgaaatgcagaaacgcgatgccaaaaagggccttgcgacattgtgcattggcggc
ggcatgggggtcgcactgtgcgtcgaacgctga

DBGET integrated database retrieval system