KEGG   Thalassospira xiamenensis: TH3_18540Help
Entry
TH3_18540         CDS       T03639                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
txi  Thalassospira xiamenensis
Pathway
txi00071  Fatty acid degradation
txi00072  Synthesis and degradation of ketone bodies
txi00280  Valine, leucine and isoleucine degradation
txi00310  Lysine degradation
txi00362  Benzoate degradation
txi00380  Tryptophan metabolism
txi00620  Pyruvate metabolism
txi00630  Glyoxylate and dicarboxylate metabolism
txi00640  Propanoate metabolism
txi00650  Butanoate metabolism
txi00900  Terpenoid backbone biosynthesis
txi01100  Metabolic pathways
txi01110  Biosynthesis of secondary metabolites
txi01120  Microbial metabolism in diverse environments
txi01130  Biosynthesis of antibiotics
txi01200  Carbon metabolism
txi01212  Fatty acid metabolism
txi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:txi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TH3_18540
   00630 Glyoxylate and dicarboxylate metabolism
    TH3_18540
   00640 Propanoate metabolism
    TH3_18540
   00650 Butanoate metabolism
    TH3_18540
  Lipid metabolism
   00071 Fatty acid degradation
    TH3_18540
   00072 Synthesis and degradation of ketone bodies
    TH3_18540
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TH3_18540
   00310 Lysine degradation
    TH3_18540
   00380 Tryptophan metabolism
    TH3_18540
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TH3_18540
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TH3_18540
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TH3_18540
Enzymes [BR:txi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TH3_18540
Exosome [BR:txi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TH3_18540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJD53810
UniProt: A0A0B4Y3J9
Position
complement(4063983..4065170)
Genome map
AA seq 395 aa AA seqDB search
MSNSDPIVIVSCARTPMGGLQGDFATVTASELGGVAIRAALEHGRVAAEDVDEVIMGNVL
PAGQGQAPARQAAWKAGIPRSAGATTINKMCGSGMKAVMFAHDTLVAGGANVMVVGGMES
MTNAPFLLPKMRSGHKYGHDMVYDHMALDGLEDAYDKGRSMGTFAEATAEKYGFTRKAQD
DYAITSLTRAQNAAKSGHFADEIAPVTYATRNGEVTIDADEQPPKAKPEKIPTLRPAFAK
DGTVTAAHSASISDGAAALVMMRASEAEKRGLKPLAKIVGQSTHAQEPCWFTTAPIDAIK
KVLGKTGWSKDDVDLWEINEAFAVVAMAAIRDLELDHGKVNVHGGACALGHPIGATGARL
LVTLIHALKTHGGTKGVASLCIGGGEATAVAIELL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattcagaccccatcgttatcgtttcctgtgccagaaccccgatgggcggcctg
cagggggatttcgcaaccgttaccgcatccgaactgggcggcgttgccatcagggccgcg
cttgagcatggccgtgttgctgccgaagatgttgacgaagtcattatgggtaacgttctg
cccgctggtcagggacaggccccggcgcgtcaggccgcatggaaggcgggtatcccgcgt
tctgccggtgcaaccacgatcaacaagatgtgcggatcgggcatgaaggccgtgatgttt
gcccatgatacgctggtcgccggtggcgccaatgtcatggttgtgggggggatggaaagc
atgaccaatgcgccgttcctgcttccgaaaatgcggtcgggccacaaatacggtcatgac
atggtttatgaccatatggcgctggatgggctggaagatgcctatgacaagggccgttcc
atggggacctttgccgaggcgacagccgaaaaatacggctttacccgcaaagcacaggac
gactatgccatcacgtcgctgactcgtgcgcagaatgctgccaagtcaggccattttgct
gatgaaattgccccggtgacctatgccacccgtaacggcgaggttaccattgatgccgat
gaacagccgcccaaggccaagccggaaaaaatcccgaccctgcgcccggcattcgccaag
gacggcacagtaaccgcggcccattcggcatcgatttccgatggggcggcggctcttgtc
atgatgcgcgcgtcggaagccgaaaagcgcgggcttaagccgcttgccaaaatcgttggt
cagtctacccacgcccaagaaccttgctggttcacgacggctccgattgatgcgatcaaa
aaggtgctgggcaaaaccggctggtccaaggacgatgttgatctgtgggaaatcaacgaa
gcctttgccgtggtggcgatggccgccatccgtgatctggaacttgatcacggcaaggtc
aatgtccatggcggtgcctgtgcgctgggccatccgataggtgccaccggtgcgcggttg
ttggtgaccctgatccatgcgcttaaaacccatggcgggaccaagggcgtggcgtcgctt
tgcattggtggcggtgaggccacggcggtcgccatcgagctgctttaa

DBGET integrated database retrieval system