KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1103Help
Entry
Thexy_1103        CDS       T01505                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
txy00030  Pentose phosphate pathway
txy00480  Glutathione metabolism
txy01100  Metabolic pathways
txy01110  Biosynthesis of secondary metabolites
txy01120  Microbial metabolism in diverse environments
txy01130  Biosynthesis of antibiotics
txy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:txy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thexy_1103
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Thexy_1103
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:txy04147]
    Thexy_1103
Enzymes [BR:txy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Thexy_1103
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Thexy_1103
Exosome [BR:txy04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Thexy_1103
  Exosomal proteins of colorectal cancer cells
   Thexy_1103
  Exosomal proteins of bladder cancer cells
   Thexy_1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N OST-HTH
Motif
Other DBs
NCBI-ProteinID: AEF17136
UniProt: F6BKK4
Position
1177133..1178611
Genome map
AA seq 492 aa AA seqDB search
MGTDNISSVMVIFGGTGDLTHRKLMPAVYNLLYDKSLPENFCVVSVGRRDKTDEIYRNEV
YESIKKFSRIKIDDELWKNLRDRIYYQKFEFNDDYGYSKLKDFLRMLDDKYQTNGNRIYY
LAVAPEYFELIVEKLHQHGMAENEKSWQRVMIEKPFGKDLNSAVYLNKKITDVFTEKNTY
RIDHYLGKEMLQNIMVIRFANVFFEPVWNNKYIDNVQISSSEMVGVENRGGYYEKAGALR
DMIQNHMLQLLTLTAMEPPIDLTTDSIHDEKVKVLKSLKELTPDLVLKNAVRGQYEGYRN
EDRVSPDSDTETFAALKVFVDNFRWAGVPFYIRTGKKLPVKSTEIVIQFKPLPGVLYFKE
YGGLMPDLLVIKIQPEEGVFLQFNAKRPGTLNKVIPVRMDFCQNCQVGMNSPEAYERLIY
DALRGDSTLFTRWDEVEYSWRYVDKIAEVWKNNKPEFPNYKPGTWGPYDADELLLRDNFK
WWNIGGFYDENV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggaacagataatatatccagtgttatggttatttttggtggcacaggagacttaact
catagaaagttgatgcccgctgtttacaatttgctttatgacaaaagccttccagaaaat
ttttgcgtcgtttcagttggaaggcgtgataagacggatgaaatttatcgcaatgaagtc
tatgaatctattaagaaattttcaagaattaaaatagatgatgagctttggaaaaattta
agagatagaatatactatcaaaagtttgagtttaatgatgactatggatactcaaaactt
aaagattttttgagaatgcttgatgataaatatcaaacaaatggaaatagaatttattac
ttggcagtagctcctgagtattttgaactaattgttgaaaagttgcatcaacatggaatg
gcggagaatgaaaagtcgtggcaaagagtcatgatagaaaaaccatttggcaaggatctg
aattctgcagtttatttaaataaaaagataactgatgtttttactgagaaaaatacgtat
cgcatagaccattatttaggcaaagaaatgttgcaaaacataatggtaatcaggtttgcc
aatgtgttttttgagccagtttggaacaacaaatatatagacaatgttcagatatcctcc
agcgagatggttggtgtagaaaatagaggtggatattatgaaaaagctggtgcgctaaga
gacatgattcaaaatcatatgttgcagcttttgacgctgactgccatggagccgcctatt
gatcttactactgattctatccatgatgaaaaagtgaaggtgttaaaatctcttaaggag
ttgacgccggatcttgtattgaaaaatgcagttagaggtcaatatgaaggctataggaac
gaggatagagtatcgcctgattccgatacagagacatttgctgcacttaaagtctttgtg
gacaattttagatgggccggtgtacctttctacataagaacaggtaaaaaattgccagta
aaatccactgaaatagtaatacagtttaaacctctcccaggcgttttgtactttaaagag
tacggtggacttatgccagacttgttagtcattaagatacaacctgaagaaggcgtcttt
ttgcagtttaatgcaaaaagacctggtactttaaataaggtgataccggtgcgaatggat
ttttgccaaaattgtcaagttggtatgaattccccagaagcttatgaaagattgatttac
gacgcgctgcgaggtgattctactctttttacaagatgggatgaagttgagtattcatgg
agatatgtagacaaaatagctgaggtctggaagaacaataaaccagagtttcccaactac
aaaccaggaacatggggaccttatgatgctgatgaattgcttcttagagataattttaag
tggtggaatataggaggtttttacgatgaaaatgtatga

DBGET integrated database retrieval system