KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1228Help
Entry
Thexy_1228        CDS       T01505                                 

Definition
(GenBank) Pyruvate carboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
txy00620  Pyruvate metabolism
txy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:txy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Thexy_1228
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:txy02000]
    Thexy_1228
Enzymes [BR:txy01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Thexy_1228
Transporters [BR:txy02000]
 Other transporters
  Primary active transporters [TC:3]
   Thexy_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: AEF17261
UniProt: F6BLL4
Position
1289920..1291314
Genome map
AA seq 464 aa AA seqDB search
MSKIKITETVLRDAHQSLLATRMTTDEMLPIAEKLDEVGFFSLEAWGGATFDACMRFLNE
DPWERLRLLKKAIKKTPLQMLLRGQNLLGYKHYPDDVVNEFIIKSVENGIDIIRVFDALN
DVRNLQVPIKSAKSAGAHVQAAIVYTVSPVHNTDHYLKVAKSLQDMGVDSICIKDMSGIL
SPYAAYDLIKSLKRALYTPIQLHSHYTAGLASMTYLKAIEAGVDGVDTAISSLALGTSQP
ATESIVAALKDTEYDTGLDLKLLAEIAQYFNVVKQNHKNDSDMSLLMSVDVKALESQIPG
GMLSNLVSQLKQQNALNKYQDVLKEVPRVREDLGYPPLVTPMSQMVGTQAVLNVITGERY
KIVPKEIKDYVKGLYGMPPAPISDSIREKIIGDEEIISNRPADLLSPQLDEFKNEIKEFI
EQDEDVLSYALFPQVARRFFEYRQAKKYKIDSTLLNIEERVHPI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagataaaaataacggagactgttttaagagatgcacatcaatcattgctggca
actaggatgacaactgatgaaatgcttcctatagcagagaaattagatgaagttggcttt
ttctcgttggaagcatggggcggtgctacatttgatgcatgtatgagattcttgaacgaa
gacccatgggaaagattaagacttttaaagaaggcgattaagaagacgcctcttcaaatg
ttgttaagaggtcaaaatttacttggatataaacactatcctgatgatgttgtaaatgaa
tttataataaaatctgttgaaaatggtatagatataataagagtttttgatgcattaaat
gatgtgagaaatttacaagtgccaataaaatctgcaaaaagcgcaggtgctcatgtgcag
gcagctattgtatatacagttagtcctgtacataatacagatcattacttgaaagtggca
aagtctcttcaagatatgggtgtggattctatatgtattaaggatatgtctggaatatta
tcaccttatgctgcatacgatctgattaaatctctaaaaagagcactttacacgccgatt
caactgcatagccattatacagcaggactggcttcaatgacttatttaaaagccatagaa
gctggtgtagacggagttgatacagccatttcttctcttgctttaggaacatcacagcca
gctacagaatcaattgtggctgcattgaaagatacagaatatgatacagggttagattta
aaattgcttgctgagatagctcagtattttaatgtggttaagcaaaatcacaaaaatgac
agcgatatgtctttgcttatgtctgttgatgttaaagcattagagagtcaaataccaggg
ggaatgttatcgaatttggtttcacagctaaagcagcagaacgcattaaacaaatatcag
gatgtcttgaaagaagttccaagggtacgagaagatttaggataccctcctcttgttact
ccaatgagtcaaatggttggaactcaggctgttttaaatgttattacaggagaaagatat
aaaatagttcctaaagaaattaaagattatgtcaaaggtttatacgggatgccaccagct
ccaatttcagattctatacgagagaaaataattggcgatgaagaaataatctcaaatagg
ccagcagatttactaagtcctcaattggatgaatttaaaaatgagataaaggaatttata
gagcaagatgaagatgttttatcatatgcattatttcctcaagtagcaagaaggtttttt
gagtataggcaagctaaaaaatacaaaattgattcaacattattgaatatcgaagagagg
gttcacccaatataa

DBGET integrated database retrieval system