KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1295Help
Entry
Thexy_1295        CDS       T01505                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
txy00900  Terpenoid backbone biosynthesis
txy01100  Metabolic pathways
txy01110  Biosynthesis of secondary metabolites
txy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thexy_1295
Enzymes [BR:txy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Thexy_1295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C PrpR_N Mur_ligase Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEF17328
UniProt: F6BFI9
Position
complement(1360770..1361918)
Genome map
AA seq 382 aa AA seqDB search
MKNIVVLGSTGSIGTQTLDVVRKSKEFRVIGLTCYNNIDLIKQQIDEFKPQFVAVKDESS
AKKLKEIVDTNTVILSGDDGINEVASLSNVQTVVVAIEGIAALIPTIKAIETGHNIALAN
KECLVTGGHIIKKLAIEKNINIFPVDSEHNAIYQCIQSGKKEFVNKLIITASGGPFRGKT
LSDLKSVTVEEALNHPNWKMGKKITIDSATLMNKGFEVIEAKWLFDVPLEKIEVVVHKES
IIHSMVEFIDGSIIAEMATADMRIPIQYALNFPNRVYVEGVRYLDIAKIGSLSFEKPDVN
TFRCLQLAYDALEEGGTMTTVLNTADEVAVQLFLERVISFNDIPYIIEKYMNNHKNIINP
ELNDIIEVDKEIREKIKREYMR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattgtcgttttaggttctacaggttcgattggaactcaaacacttgatgtg
gtaaggaaatcaaaagaatttcgtgttataggacttacatgttataataatattgatctt
ataaagcaacaaattgatgaatttaaaccgcaatttgttgctgttaaggatgaatcgtct
gcaaaaaagttaaaagaaattgtggacactaatacagtgattctctctggtgatgatgga
ataaacgaggtagcttctctttcaaatgttcagactgttgttgtggccattgaaggcata
gcagcgcttattcctactataaaggcgattgaaacagggcataacattgcacttgctaat
aaagaatgtttagtcactggtgggcacataattaagaaactggcaattgaaaaaaacata
aatatatttcctgttgacagtgaacacaatgcgatttaccaatgtattcaatctggaaaa
aaagaatttgtaaataaattgattataactgcatctggaggaccctttagaggaaaaaca
ttaagcgatttaaaatccgtgacagttgaagaagctttaaatcatcctaattggaagatg
ggcaaaaaaataacaatcgattctgccacacttatgaataaagggtttgaggtaatagaa
gctaaatggctttttgatgtgccattagaaaaaatagaagttgttgtgcataaagaaagc
ataatccattcaatggtagagtttattgatggaagcattattgcagaaatggctactgcc
gatatgaggataccgatacagtacgctttaaatttccccaacagggtatacgtggaaggt
gtacgatatttagatattgccaagattggaagtctatcatttgaaaaaccagatgttaat
acttttagatgcctccaactggcatatgatgcattggaagaaggcggaacaatgacaaca
gttttaaatacagcagatgaagtagcagttcaattgtttttagaaagagtaatttcgttt
aatgatattccttatataatagaaaaatatatgaataatcataaaaacatcattaatcct
gaattaaatgatataatagaagtagataaagaaataagggaaaaaattaagcgtgaatat
atgaggtga

DBGET integrated database retrieval system