KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1897Help
Entry
Thexy_1897        CDS       T01505                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
txy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:txy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Thexy_1897
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:txy03400]
    Thexy_1897
Enzymes [BR:txy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Thexy_1897
DNA repair and recombination proteins [BR:txy03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Thexy_1897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 Viral_helicase1 HHH_5 AAA_11 Helicase_RecD PIF1 PhoH HHH_2 DUF2075 UvrD_C AAA_22 ATPase_2 T2SSE KAP_NTPase NTPase_1 Rad17 AAA_28 RsgA_GTPase AAA ABC_tran AAA_23 AAA_18 AAA_12 UvrD-helicase AAA_16 Thymidylate_kin cobW
Motif
Other DBs
NCBI-ProteinID: AEF17916
UniProt: F6BJ99
Position
complement(1967529..1969817)
Genome map
AA seq 762 aa AA seqDB search
MICASNVYENNIQLKIENKKVGIDMVEIIGTVEEIIFKNEQNGYAVLELNSKNDTITVVG
YMPFVGIGETLKVEGEWMTHPDYGEQVKVSKYETIAPSTLYGMERFLSSGLIRGIGPVMA
KKIVSKFGVDSLNIIESHPEKLLDIPGIGEERVKMISESYEQQKTLRDVMVFLQGYGIST
TNAIKIYRQYGDDSIELIKQNPYRLSDEIFGIGFRTADKIARAMGVDLHSSYRISSGTKY
VLIQYASNGHTYVPLELLLKEAAKLLEVSEEEVYDSLVLLAQSEKVKFETFEDGSHGVYY
IPYFVAENNTADKILNMTLTDVKPEDIDIESEISKIESDMGIHLADNQRVAVLESVKNSI
LVITGGPGTGKTTIINFIIKLFKKFKKSVALTAPTGRAAKRMTEATGFEAKTIHRLLEYS
YTEEEGRGFGKDDKNPLTEDVIIVDEASMIDILLMNALLKAIPLSSRLILVGDVDQLPSV
GAGNVLRDIIDSGLVKVIRLNKIYRQGKESLIVVNAHKINNGEYPVLNDKENDFFFINAS
SQDEILNIILDLCKRRLPEAYGFNPFTDIQVLSPTRKGLIGVINMNNELQRCLNPSKKGL
DERQMKDFTFRVGDKVMQMKNNYKMKWTKGDEKGEGVFNGDMGIIESIDNDSQELTVLFD
DDKRVVYDFADIDELSLSYCVTVHKSQGSEFPAVIMPMSFGPPMLLTRNLLYTAVTRAKK
LVVIVGQEKYLKSMIDNNLISKRYSGLLPKLMKVLKFMVEEN
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgatatgtgcttcaaatgtatatgaaaataatatacaattaaagatagaaaataaaaaa
gtagggatagatatggttgaaataataggtacagttgaggagataatttttaaaaatgaa
caaaatgggtatgctgtattagaacttaattcgaaaaatgacactatcaccgttgtagga
tatatgccttttgttggaataggtgagacgcttaaagttgaaggtgaatggatgacgcat
cctgactatggggaacaggtgaaagtttcgaagtatgagacgatagcgccgtcaacgttg
tatgggatggagaggtttttatcatctggactcattagaggtataggtcctgtcatggcg
aaaaagattgtctcaaaattcggcgtcgattctctaaacattatagaatctcatccagaa
aaattattggatatacctggaataggcgaagaaagagtaaagatgatatcagaatcttat
gagcagcagaagacattgagggacgtgatggtttttttacaaggttatggcatttctacc
acaaatgcaattaaaatatataggcaatacggcgatgattctatagaactcataaagcag
aatccgtacagactatcggatgaaatttttgggattggctttaggacggctgataagata
gctcgagcaatgggtgttgacttgcattccagctataggatttcatctggcacaaagtac
gttttgatacaatatgcatcaaatggccatacgtatgtgccacttgaacttttgcttaaa
gaagcagcaaaacttcttgaagtatcagaagaagaagtttatgattcgttggttcttctg
gcacaaagcgaaaaagtgaagtttgagacatttgaagatggctctcacggcgtgtattat
ataccgtattttgtagctgaaaacaacaccgcagataagattttaaacatgacgctgaca
gatgtaaagcctgaggatattgatattgaaagtgaaatatcgaagatagaatcagatatg
ggaattcatcttgcagacaatcagcgtgttgcagttttagaatctgtcaagaactcaatt
ctcgtcataacaggtggacctgggacgggaaagaccaccataataaatttcattataaag
ctttttaaaaaatttaaaaaatcggtagcattaactgcacctacaggaagagctgcaaag
aggatgactgaagctacaggttttgaagctaagacgatacatcgccttttagagtattca
tacactgaagaagaaggacgagggtttggaaaggatgataaaaacccattgacagaagat
gtcataatagtagacgaggcttcgatgatagacatattgcttatgaatgctcttcttaaa
gctattccgttaagctcaagattgatacttgttggagatgtggatcagcttccgtctgtt
ggagctggcaatgtgcttagagacatcatagatagcggcttggtaaaagttataaggctt
aataagatatacaggcaagggaaggaaagtttgatagtagtaaatgcccacaagataaac
aatggagagtaccctgtgttaaatgataaagaaaatgactttttctttataaatgcttca
tcacaagacgaaattttaaatattatattggatttatgtaaaaggcggttgcctgaagcg
tatggatttaacccttttacagatattcaagttttaagccccacgagaaaaggcttgata
ggtgtaataaacatgaacaatgaactgcaaaggtgcttaaatccttcgaaaaagggattg
gatgagaggcagatgaaagattttactttcagagtaggagacaaggtgatgcagatgaaa
aacaactacaagatgaagtggacaaaaggagacgaaaaaggtgaaggcgtctttaatggt
gatatgggtatcatagagtctatcgataatgattcacaggagcttactgttttatttgat
gatgataagcgggttgtttacgattttgcagatatagatgagttaagcctttcttactgt
gtgactgtccacaaaagccaaggaagtgaatttccggctgtcatcatgcctatgagcttt
ggaccgcctatgcttcttaccagaaaccttctgtatacggctgttacgagggctaaaaag
cttgtggtaatagttggccaagaaaaatacttaaaaagtatgatcgacaataatcttata
tcaaagaggtactcagggcttttacctaaacttatgaaagtccttaaattcatggtggaa
gaaaattga

DBGET integrated database retrieval system