KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0404
Entry
THEYE_A0404       CDS       T00775                                 
Name
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00230  Purine metabolism
tye01100  Metabolic pathways
tye01232  Nucleotide metabolism
Module
tye_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tye00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    THEYE_A0404
Enzymes [BR:tye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     THEYE_A0404
SSDB
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 MobB Mg_chelatase AAA_33 ABC_tran RNA_helicase NTPase_1 AAA_16 T2SSE Rad17 GTP_EFTU AAA TsaE cobW
Other DBs
NCBI-ProteinID: ACI21848
UniProt: B5YJ36
Position
complement(391407..392021)
AA seq 204 aa
MEIYKKGIIFVISAPSGTGKTTLCERLLKILPDLKMSISHTTRQPRPYEKNGVDYFFVDK
KNFEKMIVNDEFIEWAEVYGNFYGTSKKVIFDLIKNGYDILLDIDTQGAKNIRKLYPDSV
LIFILPPSLKELEKRLLLRNEDKDIIDKRLSKASQEISQYKFYDYVVINDSIERALNDLL
CIIYAERLKTKRIEHNKIDEIFKK
NT seq 615 nt   +upstreamnt  +downstreamnt
atggagatttataaaaagggaattattttcgttatatctgctccttcaggaactgggaaa
acaacattgtgtgagagattacttaaaatattaccagatttaaaaatgagtatttcccat
acaacaaggcaaccgagaccttatgagaagaatggagttgattatttttttgtagataaa
aaaaactttgaaaaaatgatagtcaatgacgagtttattgaatgggcagaggtttatgga
aatttttatggaacttcaaaaaaagttatatttgatttaatcaaaaacggatatgatata
ttgcttgacattgatacacagggagcaaaaaatataagaaagctttatcctgatagtgtt
ttaatttttattcttccaccttctctaaaggagttagaaaaaagacttttactaagaaat
gaggataaagatataatagacaaaagattgagcaaagcatctcaagaaatttctcaatat
aaattttatgactatgtcgtgataaatgatagtattgaaagggctttaaatgacttactc
tgtataatttatgcagaaagattgaaaacaaaaagaatagaacacaataaaatagatgaa
attttcaaaaaataa

DBGET integrated database retrieval system