KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0199Help
Entry
THEYE_A0199       CDS       T00775                                 

Gene name
rfaD
Definition
(RefSeq) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00540  Lipopolysaccharide biosynthesis
tye01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tye00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    THEYE_A0199 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:tye01005]
    THEYE_A0199 (rfaD)
Enzymes [BR:tye01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     THEYE_A0199 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:tye01005]
 Unusual sugar
  THEYE_A0199 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 KR adh_short
Motif
Other DBs
NCBI-GeneID: 6941944
NCBI-ProteinID: YP_002248049
UniProt: B5YHY3
Position
complement(204028..204993)
Genome map
AA seq 321 aa AA seqDB search
MNYIVVTGGAGFIGANVIKRLNELGEEKILVVDNLNKSEKWKNLVDLHFEDYIHKDKFIE
EIKNNNFNNSVKTIIHLGARSSTTEKDVDFLMINNYEYTKELAKWSLRNNVRFIYASSAA
TYGDGSNGFSDEHSLLPILKPLNAYGYSKHIFDLWALKNGILDKIVGLKYFNVYGPKEWH
KGEMRSMVLKAYEQIKKDGKIRLFKSYHNDYKDGEQLRDFIYVKDAVEMTLFFIEKTEIN
GIFNIGTGIPRSWNDLAKAVFESLGIKPQIEYIDMPEEIKGKYQYFTKADMRKMIETGYN
KPTLSLEEAIKDYVLNYLEKY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgaattacatagttgttacaggaggagctggatttattggagcaaatgttataaaaagg
cttaatgaacttggagaggaaaaaattctcgtagtagataatctaaataaatcagaaaaa
tggaaaaatcttgttgatctacattttgaagactatattcataaagataaatttattgaa
gaaataaaaaataacaatttcaataattcagtaaaaacaataattcatctcggtgcaaga
agtagcactactgaaaaagatgttgactttttaatgattaacaactatgaatacacaaaa
gaactggcaaaatggtctctaagaaataatgtgagatttatttatgcatccagtgctgct
acatatggagatggttctaatggattttctgatgaacactctttacttcctattctaaag
cccttaaatgcctatggctattccaaacatatatttgatctctgggcattaaaaaatgga
attcttgataaaatagtcgggttgaaatactttaatgtttatggaccgaaagaatggcat
aaaggtgaaatgagaagcatggtcttaaaagcctatgaacagattaaaaaagatggaaaa
ataagacttttcaaatcctaccataatgattacaaagatggagaacaattgagagatttt
atctatgttaaagatgctgtagagatgactttatttttcattgaaaaaactgagataaac
gggatttttaatataggaacaggaataccacgttcatggaatgatcttgcaaaagctgtt
tttgaatctcttggaataaagccgcagattgaatacattgatatgccagaagaaatcaaa
ggaaaatatcaatatttcacaaaagctgatatgagaaaaatgatagaaacaggctataat
aaacccactttgtctcttgaagaagctataaaagactatgtcttaaactatcttgaaaaa
tattaa

DBGET integrated database retrieval system