KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0432Help
Entry
THEYE_A0432       CDS       T00775                                 

Gene name
proB
Definition
(RefSeq) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00330  Arginine and proline metabolism
tye00332  Carbapenem biosynthesis
tye01100  Metabolic pathways
tye01130  Biosynthesis of antibiotics
tye01230  Biosynthesis of amino acids
Module
tye_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    THEYE_A0432 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    THEYE_A0432 (proB)
Enzymes [BR:tye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     THEYE_A0432 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 6941738
NCBI-ProteinID: YP_002248279
UniProt: B5YJ64
Position
complement(417571..418668)
Genome map
AA seq 365 aa AA seqDB search
MRIVVKIGSNLLTDKAGRINQKRILSLAKEVSELHNKSIEVVMVSSGAIASGLRKLGLKT
KPREIRKKQATAAVGQPLLMWMYERSFLKYKKHIAQILLTRDDLSDRIRYVNAKNTILTL
LEMDVIPIINENDTVATDEIKFGDNDQLAALVSGLIEANHLIILSDVEGLYTSDPKKDPD
AKIIKHVKEVSKELIEIAKPTSTGYGTGGMYSKVMAAKKATSFGIPVHIVSGRSYGNIKA
VIEGKQIGTYFEPVAQKVTSRKGWIAYATRAKGNLYIDEGAVKALLKNGKSLLPSGIKKV
EGDFDVGDAVYCVDEKGERIAKGLVNYSSCEIKLIKGKKSSEIEKILGYKYSDEIVHRDN
LVILI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcggattgttgtaaaaatagggagtaatcttttaactgacaaagcaggacgcattaac
caaaaaagaattctttctttggcaaaggaagtttccgaacttcataataaatcaattgaa
gttgtgatggtttcctccggagcaattgcttctggcttaaggaaactcggacttaaaact
aaacccagagaaataagaaaaaaacaggctacagctgctgttggacaacctcttcttatg
tggatgtatgaaaggtcttttcttaaatataaaaaacatatagctcagattcttcttaca
agagatgacctcagtgatagaattcgctatgttaatgcaaaaaatacgattcttacactt
cttgagatggatgttattcctataataaatgaaaacgacactgttgctacagatgaaata
aaatttggtgataatgaccagcttgcagcacttgtttcagggcttattgaagcaaatcat
ttgataattttatcagatgttgaaggactctatacatctgatcctaaaaaagaccctgat
gctaagataataaaacatgttaaagaggtttcaaaagaacttatagagatcgccaaacca
acaagcacaggatacggaacaggtggcatgtactcaaaagttatggctgcaaagaaagca
acctcatttggaatccctgttcatattgtaagcggaagaagctatggaaatattaaagct
gtaatagaaggaaaacagataggcacatactttgaaccagtagctcaaaaagtaacatcc
agaaaaggctggattgcctatgcaacaagagcaaaaggtaatctttatattgatgaaggc
gctgttaaagcattacttaaaaacgggaaaagtcttttaccatcaggaataaaaaaagtt
gaaggagattttgatgttggtgatgcagtatattgtgttgatgaaaaaggagaaagaatt
gcaaaaggattggttaactattcctcctgtgaaataaaactcataaaaggcaaaaaatct
tcagaaattgaaaaaattctcggatataaatactcagatgaaatagtccacagagataat
cttgttatccttatataa

DBGET integrated database retrieval system