KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0580Help
Entry
THEYE_A0580       CDS       T00775                                 

Definition
(RefSeq) acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00010  Glycolysis / Gluconeogenesis
tye00620  Pyruvate metabolism
tye00640  Propanoate metabolism
tye00680  Methane metabolism
tye01100  Metabolic pathways
tye01110  Biosynthesis of secondary metabolites
tye01120  Microbial metabolism in diverse environments
tye01130  Biosynthesis of antibiotics
tye01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THEYE_A0580
   00620 Pyruvate metabolism
    THEYE_A0580
   00640 Propanoate metabolism
    THEYE_A0580
  Energy metabolism
   00680 Methane metabolism
    THEYE_A0580
Enzymes [BR:tye01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     THEYE_A0580
Lipid biosynthesis proteins [BR:tye01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   THEYE_A0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 6942162
NCBI-ProteinID: YP_002248423
UniProt: B5YJK8
Position
567353..568966
Genome map
AA seq 537 aa AA seqDB search
MQDMMKKYYEEVKNFKLDVPEKFSFPLDVFDRWNDKIALIWTDGNELKKFSFSDLTRLSS
KLAGGFKKLGINKGDTVLILLPNKPEWWVIVLAVMRINAVAIPGTTLLTAKDIEYRLKAA
NIKAVISDSENASKIEEAVNKHGKDVILINIDNQQGWHKYEELLKNEAFLGEKTFSNDPA
FIFFTSGTTGLPKMVLHTQVSYPLAHIITGKFWLDLKPGEIHWNISDTGWAKAAWSSFFG
PWNMGTTVFTYYRKGKFSPSLIVETLKKYEINTICGPPTAYRMIVKELPLEELKFKTVRH
FVAAGEPLNPEIINLWKDATGEYIYNGYGQTETVNTLAMFRFIPMKPGATGFPTPGYEID
ITDDEGNPLPPNTEGNIAIKINPQRPVGLFQEYIGDKLEMAAAFRGDWYFTRDRGYKDED
GYFWFVGREDDVIISAGYRIGPFEVESALIKHPAVKEAAVVASPDEVRGEVVKAFVVLTQ
DYEPSEPLVKDIQEFVKKETAPYKYPRKIEFVDELPKTISGKIKRKELKLKEFGKLK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatatgatgaaaaagtactatgaagaagttaaaaattttaaacttgatgttcca
gaaaagttttcttttcctttggatgtttttgacagatggaatgacaaaatagcactaatc
tggacagatggtaacgaattgaagaagtttagttttagtgatttaacccgtctttcaagc
aaacttgctggagggtttaaaaaacttggtataaataaaggtgatacagttttaatactg
cttccaaacaagcctgaatggtgggtaattgttcttgcagttatgagaatcaacgcagtt
gctattcctggaacaactcttcttacagccaaggatattgaatacagattgaaagcagca
aacattaaagctgttatttcggatagtgagaatgcatcaaaaatagaagaagctgttaat
aaacacgggaaagacgtgattttgataaatatagataatcagcagggatggcataaatat
gaggaacttcttaaaaatgaagcatttttaggtgagaagacattctctaatgacccggca
tttatattttttacatcaggaacaacaggacttcccaaaatggttcttcatactcaggtc
agttaccctcttgctcacataattactggaaagttctggttggacttaaaaccaggagag
attcattggaatatttcagatacaggctgggcaaaagcagcatggtcaagcttttttgga
ccttggaacatggggacaacagttttcacctactatagaaaaggaaaattttcaccctct
ttaattgtggaaacattaaagaaatatgagataaacactatttgcggtccacctactgct
tatagaatgattgttaaagaacttcctttggaagaacttaaatttaaaacagtaagacac
tttgtggcagcaggtgaacctttaaatcctgaaataattaatctatggaaagatgcaaca
ggagaatatatttacaatggttatggacagacagaaacagtaaacactcttgctatgttc
agatttattccaatgaaaccaggagcaacaggatttccaacacctggatatgagatagat
ataacagatgatgaaggaaatccgcttcctccaaatacagaaggaaatattgcaattaag
ataaatcctcaaagacctgtgggactttttcaagaatatataggtgataaattagagatg
gctgctgcatttaggggtgattggtattttacaagggatcgtggctataaagatgaagat
ggttatttctggtttgttggaagagaagatgatgtcataataagtgctggatacaggatt
ggtccatttgaggtagagagcgctcttatcaagcatcctgcagttaaagaagctgctgtt
gttgcaagtcctgatgaggtaagaggagaagtagttaaagcattcgttgttcttacacag
gattatgaaccttctgaacctcttgttaaagatattcaggaatttgtaaaaaaagaaaca
gcaccatataagtatccaagaaaaatagaatttgttgatgaacttccgaaaacaataagt
ggtaaaataaaaagaaaagaactcaaacttaaagagtttgggaaattaaaataa

DBGET integrated database retrieval system