KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0694Help
Entry
THEYE_A0694       CDS       T00775                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00010  Glycolysis / Gluconeogenesis
tye00350  Tyrosine metabolism
tye00625  Chloroalkane and chloroalkene degradation
tye00626  Naphthalene degradation
tye01100  Metabolic pathways
tye01110  Biosynthesis of secondary metabolites
tye01120  Microbial metabolism in diverse environments
tye01130  Biosynthesis of antibiotics
tye01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THEYE_A0694
  Lipid metabolism
   00071 Fatty acid degradation
    THEYE_A0694
  Amino acid metabolism
   00350 Tyrosine metabolism
    THEYE_A0694
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    THEYE_A0694
   00626 Naphthalene degradation
    THEYE_A0694
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     THEYE_A0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 BKACE
Motif
Other DBs
NCBI-GeneID: 6942587
NCBI-ProteinID: YP_002248536
UniProt: B5YJX1
Position
complement(685357..686373)
Genome map
AA seq 338 aa AA seqDB search
MKAWVIAKINEPLRLLEMDIPFPDYKEILIKIHACGVCHTELDEIEGRAMPAFFPVIPGH
QIVGEVVKVGSAVKKFKVGDRAGVGWIYSACGKCEYCLKGLENLCKDFKATGKDAHGGYA
EYFKIHEDFAFPIPENFANEEAAPLFCAGAIGYRSLMLAKVENKQNIGLIGFGASGHLVL
KMIKYLYPDSKVFVFSRTLSERQLSMKLGAYWTGDFDETPPEKLNSAIDTTPVWKPPIKV
LKHLKPAGRLVINAIRKEEIDKNEFLNIDYQKDLWLEKEIKSVANVTRKDIEEFLKIASQ
IPIKPEIEIYSFEDANKALKDIKERKIKGAKVLKIGGE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatgggtcattgccaaaataaatgagccattgagacttttggaaatggatatt
cctttcccagattataaagaaatattaatcaaaattcatgcttgcggagtctgtcataca
gagttggacgaaatagaaggtagagcaatgccggcattttttcctgttattccagggcat
cagattgtaggagaggttgtaaaagtcggaagtgctgtaaagaaatttaaagttggagat
agagcaggtgtaggctggatttattcagcctgtggtaaatgtgagtattgtttaaaaggg
ctggaaaatctttgcaaagactttaaagcaacaggtaaagatgctcacggtggatatgca
gagtatttcaaaattcatgaagattttgctttccctattccagaaaattttgcaaatgaa
gaggcggctcctcttttctgtgcaggagcaattgggtataggtctttgatgcttgcaaaa
gttgaaaataaacaaaacattggacttattggttttggcgcatcagggcatcttgtctta
aaaatgataaaatatttgtatccagattcaaaagtttttgtattttcaagaacattgtca
gaaagacagctttctatgaaactcggtgcatactggacaggggattttgatgaaacacca
ccagaaaaattaaattcagcaattgatactactcccgtgtggaaaccgcctattaaagtt
cttaaacatcttaaacctgctggaaggcttgtaataaatgcgataaggaaagaagaaatt
gataaaaatgaattcttaaatattgattatcagaaagatttatggcttgaaaaagaaatc
aaatcagtggctaatgttacaagaaaagatattgaagaatttcttaaaattgcctcacaa
ataccaataaagcctgagattgaaatatattcttttgaagatgctaataaagcactcaaa
gatataaaagaaagaaaaataaaaggcgcaaaagttttaaaaattggaggagaataa

DBGET integrated database retrieval system