KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0860Help
Entry
THEYE_A0860       CDS       T00775                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00040  Pentose and glucuronate interconversions
tye00052  Galactose metabolism
tye00500  Starch and sucrose metabolism
tye00520  Amino sugar and nucleotide sugar metabolism
tye01100  Metabolic pathways
tye01130  Biosynthesis of antibiotics
Module
tye_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    THEYE_A0860 (galU)
   00052 Galactose metabolism
    THEYE_A0860 (galU)
   00500 Starch and sucrose metabolism
    THEYE_A0860 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    THEYE_A0860 (galU)
Enzymes [BR:tye01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     THEYE_A0860 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 6941826
NCBI-ProteinID: YP_002248699
UniProt: B5YKD4
Position
complement(831754..832623)
Genome map
AA seq 289 aa AA seqDB search
MIKKAVLPVAGLGTRFLPATKASPKEMLPIIDKPLIQYAVEEAVKAGIEEFLFITGKHKR
AIEDHFDKAYELEERLKTAGKYELLDKINCFENLNFAYIRQKEPKGLGDAILCAKPFVKD
EAFIVILSDDLIDPEYSILNEMMKIYEAKKAPVIALEEVPLSEVSRYGIVSGKTVNGYYI
IDDLVEKPEASFSPSRLAIIGRYILTPQIFKYLENLQPGKSGEIQLTDALKSLLEETAIY
GYILKGKRYDAGEKLGYLKTIVEFALKDREISSEFVKFLQEKLSNFYIN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaggctgtccttcctgtagcagggcttggaacaagatttcttcccgcaaca
aaggcttcaccgaaagaaatgcttcctataatagataaaccgcttattcaatatgcggtt
gaggaagcagtaaaagcaggaattgaagaatttttatttatcacaggtaaacataaaaga
gctattgaagaccattttgacaaagcttatgaattggaagaaagactcaaaactgctgga
aagtatgaacttttagacaaaataaactgttttgaaaatctcaattttgcatatattaga
cagaaagaacctaaaggacttggagatgctatcctctgtgctaaaccatttgtcaaagat
gaagcttttatagtaattctcagtgatgatttaatagaccctgaatactctattttgaat
gaaatgatgaaaatttatgaagcaaaaaaagctcctgtaatagctcttgaggaagttcct
ctaagtgaagtttcaagatatggcatagtttctggaaaaacagttaatggttattacatt
attgacgacttagtagaaaagcccgaagcatcttttagtccttcacgacttgcaataatt
ggcagatatatattaactcctcagatattcaaatatcttgaaaatcttcaaccaggtaaa
agcggagaaattcaattaaccgatgctttaaaatcgcttttagaggaaactgcaatatat
ggatatattcttaagggtaaaagatacgatgcaggagaaaagcttggctatttaaaaaca
atagttgaatttgccttgaaagacagggaaatttcttctgagtttgtaaaatttctacag
gaaaaactctcaaacttttacatcaactaa

DBGET integrated database retrieval system