KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0907Help
Entry
THEYE_A0907       CDS       T00775                                 

Definition
(RefSeq) pyruvate synthase subunit PorC
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00010  Glycolysis / Gluconeogenesis
tye00020  Citrate cycle (TCA cycle)
tye00620  Pyruvate metabolism
tye00633  Nitrotoluene degradation
tye00640  Propanoate metabolism
tye00650  Butanoate metabolism
tye00680  Methane metabolism
tye01100  Metabolic pathways
tye01120  Microbial metabolism in diverse environments
tye01130  Biosynthesis of antibiotics
tye01200  Carbon metabolism
Module
tye_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THEYE_A0907
   00020 Citrate cycle (TCA cycle)
    THEYE_A0907
   00620 Pyruvate metabolism
    THEYE_A0907
   00640 Propanoate metabolism
    THEYE_A0907
   00650 Butanoate metabolism
    THEYE_A0907
  Energy metabolism
   00680 Methane metabolism
    THEYE_A0907
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    THEYE_A0907
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     THEYE_A0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-GeneID: 6943175
NCBI-ProteinID: YP_002248743
UniProt: B5YKH8
Position
875496..876068
Genome map
AA seq 190 aa AA seqDB search
MEKVEIRWHGRGGQGTVTAAKVFADACLSGGRYVQAFPEYGPERAGAPLRAYNRVSSKEL
RMHCPVSNPDVVVVVDPTLIESIDVTEGAKDDAKFIINSSKEAAELRKKLNLKPTQKLYV
LDATKIAIDCFGRPMPNSPMVGALNKVTGLVNLETLLEDVKKSFGKKFSQKIIDGNLLAV
KRGYEEVKEG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggtagaaataagatggcatggaaggggagggcagggaactgtaactgctgca
aaagtttttgcagatgcctgcctgagtggtggtagatatgttcaggctttccctgaatat
ggacctgaaagagcaggtgcaccccttagggcatacaacagagtaagttctaaagaatta
agaatgcactgtcctgtctctaatccagatgtagtagttgttgttgatccaactcttata
gaaagcattgatgttacagaaggtgcaaaggatgatgctaaatttataatcaattcttct
aaagaggctgctgaattaagaaaaaaacttaatttaaaaccaacacagaaactttatgtg
cttgatgcgacaaaaattgctattgactgttttggtagacctatgcctaactcacccatg
gtaggagctttgaataaagtaacaggtttggttaatcttgaaacactgcttgaggatgtg
aaaaagagcttcggcaaaaaattttcacagaaaataattgatggtaaccttcttgcagta
aagagaggttacgaggaggtgaaagaaggatga

DBGET integrated database retrieval system