KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0966Help
Entry
THEYE_A0966       CDS       T00775                                 

Gene name
feoB1
Definition
(RefSeq) ferrous iron transport protein B
  KO
K04759  ferrous iron transport protein B
Organism
tye  Thermodesulfovibrio yellowstonii
Brite
KEGG Orthology (KO) [BR:tye00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tye02000]
    THEYE_A0966 (feoB1)
Transporters [BR:tye02000]
 Other transporters
  Others
   THEYE_A0966 (feoB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FeoB_N Gate FeoB_C FeoB_Cyto MMR_HSR1 GTP_EFTU Dynamin_N ATP_bind_1 MeaB AAA_29 AIG1 pEK499_p136 IIGP Arf ABC_tran
Motif
Other DBs
NCBI-GeneID: 6942096
NCBI-ProteinID: YP_002248799
UniProt: B5YKN4
Position
934104..936302
Genome map
AA seq 732 aa AA seqDB search
MRKVTVAVTGNPNSGKSTLINAIAGISLQIGNWPGVTVEKKTATLKIDELMVNLVDLPGT
YSLSPYTQEEVIARDFLVQEKPDLIIDVVDSTNLERNLYLTVQLLELGIPIVVTLNIFDE
AKKKGYEFDIEKLEQLLGVKVIPTVATKKEGVKEILNYIKEFANGNYAVVQQKINYGEDI
ENSIKIIEDELRVKNPALLNEYPSRWLAIKLLEEDELVLKETGIKKDESFLKKAKQHFVS
AHNKDIESILADIRYGIASGVTRDVFRKREVRRLDLTEKIDSVVLNRYLGIPIFLLAMWL
VFKIAFDFSTPLSDWIDSTVSGPVTKWSNFVLKSVGSPEWLVSLFTEGVIAGVGAVLVFV
PVIAMIMLIITLLEGSGYMARVAFVMDRLMHSIGLHGKSFIPMLLGFGCNVPSIYATRVL
ETERDRKLTAMLVPLMSCGARLPVYVIFIGAFFTQNAPTVLWSLYVLGIFMAVLLGFVLK
KTFFKGFAPVFIMELPPYRVPVFRDLMVHTWQKLKHFVIKAGTYIFAASVIMWFMLNTPY
GVEKENSVLGRVGKTISPVFAPLGFGTWEASSSLVAGLIAKEVVVSTMAQIYVGENEGEK
KKALEEGTSETPQKEEAKGFFEDLKDTVMSFAVSIKDAFLSLFSGFGIQSLSTVEGEEQR
PLQSKLQGIFTPLTAYAFLVFVLLYWPCVVVGIAMKHEFGSWKLYGQALLIHSVMAWFVA
FIIYHGGKILGF
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaagtaacagtagcagttacaggaaatccaaattcaggaaagtcaactttaata
aatgccattgcaggcataagccttcagattggtaactggcctggagtgactgtagagaaa
aagacagccactcttaaaattgatgaacttatggtaaaccttgttgaccttcctggaaca
tacagtttaagcccctacacacaggaagaggttattgcaagggattttcttgtacaggaa
aagcctgacctgataattgatgttgttgactccacaaatcttgaaagaaacctctatctt
acggtccaacttcttgagcttgggatacctattgttgttacacttaatatttttgatgag
gcaaagaaaaaaggttatgaatttgatattgaaaaactcgagcaacttcttggagtgaag
gttattcctacagtagcaaccaagaaagaaggcgtaaaagagattctcaattacataaag
gagtttgccaatggaaactatgctgtggtacagcaaaaaattaattacggagaggacata
gagaattcaataaaaataatagaggatgaattgagggtaaaaaatccagcattgctcaat
gaatatccttcaagatggcttgctataaagctccttgaagaagacgagcttgttctcaaa
gagacaggaataaaaaaagatgagtcttttttaaaaaaggcaaaacagcattttgtcagt
gctcataataaagatattgaatccatccttgctgacataagatacggaatagcgagtgga
gttacgagagatgttttcagaaaaagggaggtcaggaggcttgacctcactgagaaaatt
gatagcgtggtgcttaacagatatctgggaataccgatttttcttcttgccatgtggctt
gtctttaagatcgcctttgatttttcaacgcctctaagtgactggattgattcaacagta
agcggtcccgttacaaagtggagtaattttgtccttaagagtgttggaagtccagagtgg
cttgtatccctatttacagagggggtcattgcaggtgttggcgcagttttggtattcgtg
cctgtaattgcaatgataatgttaattatcactcttcttgaaggaagtggttacatggca
agggttgcctttgtgatggataggctgatgcactctatagggcttcatggtaaatcattc
atacccatgcttttaggctttggatgcaatgtgccctctatttatgctacccgtgttctt
gaaacagaaagagacagaaagcttacagccatgcttgtgccacttatgtcatgcggtgcg
agacttcccgtttatgtgatatttattggtgctttctttactcagaatgctcctacggtg
ttgtggtccctctatgtgctcggaatattcatggcggtgttacttggatttgtcctaaag
aaaactttctttaaaggttttgcacctgttttcataatggaacttcctccctacagagtt
ccagttttccgagacctgatggttcatacatggcaaaaactcaaacattttgtaataaag
gctggaacctatatttttgctgcatcagttataatgtggtttatgctaaacactccctat
ggagttgaaaaagaaaactctgtgcttggtagagttggaaaaacaataagtcctgtcttt
gcacctctcggatttggtacttgggaagcttcatcaagccttgttgcaggcttgattgca
aaagaggtcgtggtaagcacaatggcacagatatatgtgggagaaaatgagggagaaaag
aaaaaagctttagaagaaggcacttctgagactcctcaaaaggaagaggcaaaaggattt
tttgaagatttgaaagatactgtgatgtcctttgcagtttcaattaaagatgcttttttg
agtttgttttcaggatttggtatacagagtttgtcaactgtagaaggtgaggaacaaaga
ccgcttcagtcaaagctgcaaggaatttttacccctcttactgcctatgcttttctggtg
tttgttcttctttactggccctgcgtggttgtgggaattgccatgaagcatgagtttgga
agttggaagctatatggacaagcattacttattcattcagtgatggcttggtttgttgct
ttcattatctatcatggaggaaaaattcttggtttttag

DBGET integrated database retrieval system