KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1047Help
Entry
THEYE_A1047       CDS       T00775                                 

Gene name
proS
Definition
(RefSeq) prolyl-tRNA synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00970  Aminoacyl-tRNA biosynthesis
Module
tye_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tye00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    THEYE_A1047 (proS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tye01007]
    THEYE_A1047 (proS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tye03016]
    THEYE_A1047 (proS)
Enzymes [BR:tye01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     THEYE_A1047 (proS)
Amino acid related enzymes [BR:tye01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   THEYE_A1047 (proS)
Transfer RNA biogenesis [BR:tye03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    THEYE_A1047 (proS)
 Prokaryotic Type
    THEYE_A1047 (proS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b tRNA_edit HGTP_anticodon zf-ribbon_3 HTH_AraC
Motif
Other DBs
NCBI-GeneID: 6941889
NCBI-ProteinID: YP_002248875
UniProt: B5YKW0
Position
complement(1015759..1017474)
Genome map
AA seq 571 aa AA seqDB search
MRYSKLFIPTMREIPSGINAISHILMLKAGYVRQLAAGLFIFLPLGWRVLNKINMILKEE
MERIGAQEISMPILHPAEIWQETGRWYTIKEEMFRLKDRTGRDMCLGMTHEEIMTWIASK
EIKSYRQLPQIWYQIQTKLRDEARPRGGVLRTREFIMKDSYSFDIDWEGLDKSYNLHAEA
YHRIFTKCGLKYYQVESDPGIMGDMESHEFMAPTPAGEDEIVLCDSCGYSANIEVAKSEL
PTLPSLNFEYKEIYTPEKKSVKEVSDFLGLSEKYFIKTLIVISEKNGPVLVMLRGDQELN
EKKLARIIGEFSFATSEQALEILGVELGFVGPVGHKIKKIADFSIQKEISYISGANKKNY
HLQGIIPGIHFDAQWADIRRVKEEDRCPKCGNSLKIEKAIEVGNIFKLGTKYTEPLHAYF
LDKDGKEKPIIMGSYGIGPARVAAAAIEQNHDSDGIIWPKSISPFDIEIIPLNMDDEKTV
SIAEELYEKVTEIYNSFADRHMEVLIDDRDERPGVKFKDADLIGIPIQIVIGKKGLKENK
VEIKKRRTKETKKVSVNKAVVEIVNSYYETY
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgagatattctaagttgtttattcctacaatgagagaaattccttctggaatcaatgca
atatctcatattttaatgcttaaggctggatatgtaaggcagcttgctgcaggattgttc
atttttttgccacttggttggcgtgttttaaataaaataaacatgatattgaaagaagaa
atggaacgaattggtgcacaagaaatttcaatgcccattctccatccagcagagatatgg
caagaaacaggtagatggtataccataaaagaggaaatgttcagactcaaagatagaact
ggtagagatatgtgtcttggaatgactcatgaagaaattatgacatggatagcttctaaa
gaaataaagtcctatagacaactacctcaaatatggtatcaaattcaaacaaaattaaga
gatgaagcaagaccgcgcgggggtgttttaaggacaagagaatttatcatgaaggacagt
tacagttttgatattgactgggaaggactggataaaagttataatcttcatgcagaagca
tatcatagaatttttacaaaatgtgggttaaaatactatcaagttgaatcagatcctgga
ataatgggtgacatggaatctcatgagtttatggctccaactccagctggtgaagatgaa
attgttttatgtgatagctgcggatattctgccaatatagaagtagctaaatctgaatta
cctaccctaccttctttaaattttgaatacaaagaaatatacactccagagaaaaagtca
gtaaaagaagtatcggattttttaggattaagtgaaaaatattttataaaaactcttata
gttatatctgaaaaaaacggtcctgtattggttatgcttagaggagaccaagagttaaat
gaaaaaaagcttgcaagaattattggagaattcagctttgccacatcagaacaggcatta
gaaatacttggtgtagaacttggatttgtcggacctgtaggacataaaatcaaaaaaata
gcagatttttcaattcaaaaggaaatttcctatatttcaggagcaaataaaaagaattat
catctacagggaattattccagggattcactttgatgctcaatgggcggatataagaaga
gttaaagaagaagacagatgtcctaaatgtggcaactctttaaaaattgagaaagcaatt
gaagttggaaatatctttaaacttggcacaaaatatactgagcctttgcatgcttatttt
ttagataaagatggaaaggaaaaaccaattatcatgggaagttacggaataggaccagca
agggttgctgcagctgcaatagaacagaatcatgacagtgatggaataatatggcctaaa
agcatatctccttttgacattgagattattcctctcaatatggatgatgaaaaaaccgtt
agtatagcagaagaattatatgaaaaagttactgaaatatataatagttttgcagacaga
catatggaagttttaattgatgatagagatgaacgaccaggagttaaatttaaagatgct
gatttaatcggaataccgattcaaattgtaataggaaaaaagggattgaaagaaaataaa
gtggaaatcaaaaaaagaaggacaaaagaaactaaaaaagtttctgtgaataaagcagtt
gttgaaatagtcaacagctattatgaaacatattga

DBGET integrated database retrieval system