KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1144Help
Entry
THEYE_A1144       CDS       T00775                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00010  Glycolysis / Gluconeogenesis
tye00051  Fructose and mannose metabolism
tye00562  Inositol phosphate metabolism
tye01100  Metabolic pathways
tye01110  Biosynthesis of secondary metabolites
tye01120  Microbial metabolism in diverse environments
tye01130  Biosynthesis of antibiotics
tye01200  Carbon metabolism
tye01230  Biosynthesis of amino acids
Module
tye_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THEYE_A1144 (tpiA)
   00051 Fructose and mannose metabolism
    THEYE_A1144 (tpiA)
   00562 Inositol phosphate metabolism
    THEYE_A1144 (tpiA)
Enzymes [BR:tye01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     THEYE_A1144 (tpiA)
Exosome [BR:tye04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   THEYE_A1144 (tpiA)
  Exosomal proteins of bladder cancer cells
   THEYE_A1144 (tpiA)
  Exosomal proteins of melanoma cells
   THEYE_A1144 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ECH_1
Motif
Other DBs
NCBI-GeneID: 6941963
NCBI-ProteinID: YP_002248968
UniProt: B5YL53
Position
1122803..1123543
Genome map
AA seq 246 aa AA seqDB search
MPKKFIVANWKMHKTVREALAFLDEFIPITKGLNGREIGIAPTFICIESVGKVLINTSIK
LCAQNAFYENKGAYTGEVSPAMLKDCGVEYVIIGHSERRKYFYENDDIINKKIHACIKEG
LKVIFCIGETFEDRQNNKTMEILKTQIRNGLLEINSPEALTIAYEPVWAIGTGVVATEEQ
IKQSHLFIRNQLKEIYGERANEVRILYGGSVTPENIKSIMAIDNVEGVLVGGASLDPLKF
AKIVKY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagaaatttattgttgccaactggaagatgcataaaacagtgagagaagctctt
gcatttctggacgaatttattccaattactaaggggttaaacggcagagagataggtatc
gcaccaacttttatttgtattgaaagcgttggcaaagttttgataaataccagcataaaa
ctctgtgcacaaaatgctttctatgaaaacaaaggagcctacacaggtgaagtatctccg
gcaatgctaaaggattgtggtgttgaatatgtaataatcggacattcggaaagaagaaag
tatttttatgaaaatgatgacattattaataaaaagattcatgcttgtattaaagaagga
ttgaaagtgattttctgtattggtgaaacctttgaagatagacagaacaataaaacaatg
gaaattttaaaaactcaaatcagaaatggactgttggaaataaattctccagaagccctt
acaattgcctatgagcctgtatgggcaattggaacaggcgttgtagccactgaagagcaa
ataaaacaatcacacttgttcataaggaatcagcttaaggaaatctatggtgaaagagct
aatgaggttaggattctttacggggggagtgtgactccagaaaacatcaagtctattatg
gcaattgataatgttgaaggagttctggttggtggtgcaagtttagatcctttaaagttt
gcaaaaattgtaaagtattaa

DBGET integrated database retrieval system