KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1837Help
Entry
THEYE_A1837       CDS       T00775                                 

Gene name
rdgB
Definition
(RefSeq) RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:tye00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    THEYE_A1837 (rdgB)
Enzymes [BR:tye01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     THEYE_A1837 (rdgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 6943192
NCBI-ProteinID: YP_002249628
UniProt: B5YHP2
Position
complement(1763983..1764597)
Genome map
AA seq 204 aa AA seqDB search
MKIVIASRNRKKIEELKRILQGLEITILSVNDFPELEEVKEDGLTFDENALKKARYVCQQ
TGLPALSDDSGLEVEALGGRPGVRSARYAGDEASDDDNIKKLLEELAGVPSEKRTAQFVC
CIALVFPDGKEYIFWGYVRGKISEIPRGTQGFGYDPVFIPEGFKKTFAEMSPHEKDKISH
RKEALDKLRDFLIKFAPIYKQNLL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagttattgcttcaagaaacagaaaaaaaatagaagagttaaaaagaattttg
caaggacttgaaattactattctttctgttaatgattttcctgaacttgaagaagttaag
gaagatggattaacttttgatgaaaatgctttaaaaaaagcaagatatgtttgtcaacaa
actggattgcctgctctttctgatgattcaggtttggaagttgaggcattaggaggcaga
ccaggtgtcagatcagcaagatatgcaggagatgaggcaagtgatgatgataacatcaaa
aaacttcttgaagaattagcaggagttccttcagaaaagagaactgcgcaatttgtgtgt
tgcattgcgctggtttttccggacgggaaagagtatatcttctggggatatgttagaggt
aaaatctcagagattccaagaggaactcagggttttggatatgatcctgtatttataccc
gaaggatttaaaaaaacatttgctgaaatgtccccccatgaaaaagataagataagtcat
cgtaaagaagcacttgacaaattaagagattttttgataaaatttgccccaatttataag
caaaacttattataa

DBGET integrated database retrieval system