KEGG   Ursus arctos horribilis: 113240844Help
Entry
113240844         CDS       T05909                                 

Gene name
PPIB
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase B
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
uah  Ursus arctos horribilis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:uah03110]
    113240844 (PPIB)
Enzymes [BR:uah01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     113240844 (PPIB)
Chaperones and folding catalysts [BR:uah03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    113240844 (PPIB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 113240844
NCBI-ProteinID: XP_026334058
UniProt: A0A3Q7UD14
Position
Unknown
AA seq 216 aa AA seqDB search
MLRLLERNMKVLFAAALIAASVFFLLLPGPSTADEKKKGPKVTVKVYFDLRIGDEDIGRV
VIGLFGKTVPKTVDNFVALATGEKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVR
KVESTKTDSRDKPLKDVTIADCGKIEVEKPFAIAKE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctcttggagcggaacatgaaggtgctgttcgccgccgccctcatcgcggcc
tccgtcttcttcctgctgttgccaggtccctccacggccgacgagaagaagaaggggccc
aaagtcaccgtcaaggtgtactttgacctgcgaattggagatgaagatataggccgggtg
gtcatcggtctctttggaaagactgttccaaaaacagtggataattttgtggccttagcc
acgggagagaaaggatttggctacaaagacagcaaattccatcgcgtgatcaaggacttc
atgatccagggtggagactttacccggggagacggcactggaggaaagagcatctatggt
gaacgcttccccgatgagaacttcaagctgaaacactacgggcctggctgggtgagcatg
gccaacgcgggcaaagacaccaacggctcccagttctttatcacgacggttaagacagcc
tggctagatggcaagcatgtggtgttcggcaaagttctggaaggcatggaggtagtacgg
aaggtggagagcaccaagaccgacagtcgggacaagcccctgaaggatgtgacgatcgca
gactgtggcaagatcgaggtggagaagccctttgccatcgccaaggagtag

DBGET integrated database retrieval system