KEGG   Ursus arctos horribilis: 113243744Help
Entry
113243744         CDS       T05909                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
uah  Ursus arctos horribilis
Pathway
uah03040  Spliceosome
uah04010  MAPK signaling pathway
uah04141  Protein processing in endoplasmic reticulum
uah04144  Endocytosis
uah04213  Longevity regulating pathway - multiple species
uah04612  Antigen processing and presentation
uah04915  Estrogen signaling pathway
uah05134  Legionellosis
uah05145  Toxoplasmosis
uah05162  Measles
Brite
KEGG Orthology (KO) [BR:uah00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113243744
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113243744
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113243744
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113243744
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    113243744
  09152 Endocrine system
   04915 Estrogen signaling pathway
    113243744
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    113243744
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    113243744
  09172 Infectious disease: viral
   05162 Measles
    113243744
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    113243744
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113243744
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:uah03041]
    113243744
   03009 Ribosome biogenesis [BR:uah03009]
    113243744
   03110 Chaperones and folding catalysts [BR:uah03110]
    113243744
   04131 Membrane trafficking [BR:uah04131]
    113243744
   03051 Proteasome [BR:uah03051]
    113243744
   03029 Mitochondrial biogenesis [BR:uah03029]
    113243744
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113243744
Protein phosphatases and associated proteins [BR:uah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     113243744
Spliceosome [BR:uah03041]
 Complex B
  Other components
   Prp19 complex
    113243744
 Complex C
   Prp19-CDC5 complex
    113243744
Ribosome biogenesis [BR:uah03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    113243744
Chaperones and folding catalysts [BR:uah03110]
 Heat shock proteins
  HSP70 / DNAK
   113243744
Membrane trafficking [BR:uah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    113243744
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    113243744
Proteasome [BR:uah03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113243744
Mitochondrial biogenesis [BR:uah03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    113243744
Exosome [BR:uah04147]
 Exosomal proteins
  Proteins found in most exosomes
   113243744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 113243744
NCBI-ProteinID: XP_026338335
UniProt: A0A3Q7UDP8
Position
Unknown
AA seq 641 aa AA seqDB search
MAAAKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEGGKPKVMVSYKGEKKAFYPEE
ISSMVLTKMKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKAGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKISA
KNALESYAFNMKSAVSDEGLKGKISESDKKKILDKCNEVLSWLEANQLAEKEEFDHKRKE
LEQVCNPIITKLYQGGCTGPSCGTGYTPGRAATGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctaaaggaatggccatcggcatcgacctgggcaccacctactcctgcgtg
ggggtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacc
cccagctacgtcgccttcaccgataccgagcggctcatcggggatgccgccaagaaccag
gtagccatgaatccccagaacactgtctttgatgccaaacgtctgattggcaggaagttt
aatgatcctgtagtacaatcagatatgaaactttggccttttcaagtaatcaatgaagga
ggcaaacccaaggtaatggtgtcatacaaaggggagaaaaaagctttctatcctgaggaa
atctcttctatggtactgacaaagatgaaggagactgctgaggcttttttgggccaccct
gttaccaatgccgtgatcactgtaccagcctatttcaatgattctcaacgccaggccacc
aaggatgcaggtgtgattgcgggtctcaatgtgctaagaattatcaatgaacccacagct
gctgccattgcatatggcttagataaagcaggtcagggagagcgacacgtcttgatcttt
gatctaggtggaggcacatttgatgtgtccatcctgaccatagatgatggaatttttgag
gtaaaggccacagccggggacacccacctgggaggggaagactttgataacaggctggtg
agccacttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcga
gccgtgaggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacc
caggccaacttggaaattgattcactttatgaaggcattgacttctacacatccatcacc
agagcccggtttgaagagttgtgtgcagacctgtttagaggcactctggaacctgtggag
aaggcccttcgggatgccaagatggataaggctaagatccatgacattgtgttagtgggg
ggctccactcgtatccctaaggttcagaggctgctgcaggactactttaatggtcgtgat
ctcaacaagagcatcaatcctgatgaggcggtggcctacggggcggcagtgcaggcagcc
atcttgatgggggacaagtctgaaaaggtacaggatctgcttttgttggatgtggctccc
ttgtccctagggttggaaacggctgggggtgtcatgacagtcctgatcaagcgcaactcc
accatccccaccaagcagacacagattttcaccacctattcagataaccagcctggggta
ttgatccaggtgtatgagggcgagagagccatgacccgagataacaacctcctggggcgg
tttgacctgactggaatccctcctgcacccaggggagtgcctcagattgaggtgaccttt
gacattgatgccaatggtattctcaatgtaacagccatggacaagagcacaggcaaggcc
aataagatcaccatcaccaatgataagggccgcctgagcaaagaggagatcgagcgcatg
gttctggatgctgagaagtataaagccgaggatgaggttcagagagagaaaatctctgca
aaaaatgctttagaatcttatgcttttaacatgaagagtgctgtgagtgatgaaggcttg
aagggcaagattagtgagtctgataaaaagaaaatactggataaatgcaatgaggtcctt
tcgtggctggaggccaatcaactggctgagaaagaggagtttgatcataagagaaaggaa
ttggagcaggtgtgtaacccaatcatcacaaaactctaccagggaggatgcactgggcct
tcctgtgggacggggtatactcctggaagggcggccacaggccccaccattgaagaagta
gattaa

DBGET integrated database retrieval system