KEGG   Ursus arctos horribilis: 113244188
Entry
113244188         CDS       T05909                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
uah  Ursus arctos horribilis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:uah03036]
    113244188 (ANKRD53)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    113244188 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3
Other DBs
NCBI-GeneID: 113244188
NCBI-ProteinID: XP_026339173
UniProt: A0A3Q7USI5
Position
Unknown
AA seq 490 aa
MQPAEKVSYKVTCSDAASQQPRAASPDPDPAFPLACPLPTLHPCAHAKPDDEWDQSAIGS
YYELFAAALGNLEWLRFCLSRDRDKIPADDKGFTAIHFAAQSGKLPCLQLLVEEYQFPVD
LPTSNGQTPLHLVIHGDNKTMTLPCIHYLLKRGAALNTQTSNGSTPLHLAASKGLLSCVK
VLVQNGANVHARDTVGCKPIDYCKIWNHRDCARFLKDAMWKRDKKDFAREMGKLKRLKDQ
LAFMEQDYLTEYQKEHQILREADFKKWLHCKQLLRGQTLICKAKQVPCAAPQAIPVSKTS
KHQRPWKSFYPSPEARLRQTSGPKLQPLGTPTPIYTHPMVRRPKSWNVSNNPARLPTTQI
GYPQGIRLGVHPDPSPEQDFRGFLEVRSDRHGGAQLCTVAGHRVAPVPQLPFEVIVRELH
PSVWPPRMKVPQGFCPVSMRNVPQKRHLGDDNFWTDTLAMNLRETFDEAFLAAVRAHQGL
PTLPSPKSPP
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgcagccggcggagaaagtctcgtacaaggtcacatgttccgacgcggcgtcccagcag
cccagggccgccagcccagacccagacccggctttcccgctcgcctgcccactcccgacc
ctccatccctgcgcccacgctaagcccgatgatgagtgggaccagagtgccattgggagc
tactacgagttgttcgcggccgcactgggcaacctggaatggttgcgcttctgtctgagt
cgggaccgggacaaaattccggcagatgacaagggcttcaccgccatccactttgcagcc
cagagtggcaagctgccgtgcctgcagctcttggtagaggagtaccagtttcccgtggac
ctgcccaccagcaatggccagacacccctgcacctggtcatccacggggacaacaagacc
atgaccctcccctgcattcactatctacttaagcgaggggcggccctcaacactcagaca
agcaatggctccacacccctccacctggcagccagcaagggcttgctgagctgcgtgaag
gtgctggtgcaaaatggtgccaatgtccatgcccgagacaccgtgggctgcaagcccatc
gactactgcaaaatatggaaccaccgcgactgtgcccggttcttgaaggatgccatgtgg
aaacgggacaagaaggactttgctcgtgagatggggaaactgaagaggctcaaggaccag
ttggccttcatggaacaggactacctgactgagtatcaaaaagagcaccaaattctgaga
gaagctgatttcaagaagtggctccattgcaagcagctgctccggggccaaaccctgatc
tgcaaggccaagcaagtgccttgtgccgcacctcaggcgatccccgtctccaagacctcc
aagcaccagaggccttggaagagcttctacccctccccagaggcacgcctgaggcagaca
tcagggcccaagctgcagcccttggggacacccacacccatctacacccaccccatggtc
agacggcccaagtcgtggaatgttagcaataaccctgccagattgcccaccacccagatc
ggctacccacagggcatccgcctgggtgtgcatccagaccccagcccagagcaagacttc
cgcggcttcctggaggtgaggtctgacaggcacggcggtgcgcagctgtgcacggtggcc
ggccaccgggtggcgcctgtgccccagctgcctttcgaggtgatagtccgagagctgcac
ccttcagtgtggccacccaggatgaaagtgccccagggcttctgccctgtcagcatgagg
aatgtgccccagaagcggcacttgggtgacgacaacttctggaccgacactctggccatg
aacctccgtgagacatttgatgaagccttcctggcagctgtgcgagcccatcaagggctc
cccactctgccctcccccaaaagccccccataa

DBGET integrated database retrieval system