KEGG   Ursus arctos horribilis: 113246056
Entry
113246056         CDS       T05909                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah00230  Purine metabolism
uah01100  Metabolic pathways
uah01522  Endocrine resistance
uah04015  Rap1 signaling pathway
uah04020  Calcium signaling pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04072  Phospholipase D signaling pathway
uah04114  Oocyte meiosis
uah04211  Longevity regulating pathway
uah04213  Longevity regulating pathway - multiple species
uah04261  Adrenergic signaling in cardiomyocytes
uah04270  Vascular smooth muscle contraction
uah04371  Apelin signaling pathway
uah04540  Gap junction
uah04611  Platelet activation
uah04713  Circadian entrainment
uah04714  Thermogenesis
uah04723  Retrograde endocannabinoid signaling
uah04724  Glutamatergic synapse
uah04725  Cholinergic synapse
uah04727  GABAergic synapse
uah04742  Taste transduction
uah04750  Inflammatory mediator regulation of TRP channels
uah04911  Insulin secretion
uah04912  GnRH signaling pathway
uah04913  Ovarian steroidogenesis
uah04914  Progesterone-mediated oocyte maturation
uah04915  Estrogen signaling pathway
uah04916  Melanogenesis
uah04918  Thyroid hormone synthesis
uah04921  Oxytocin signaling pathway
uah04923  Regulation of lipolysis in adipocytes
uah04925  Aldosterone synthesis and secretion
uah04926  Relaxin signaling pathway
uah04927  Cortisol synthesis and secretion
uah04928  Parathyroid hormone synthesis, secretion and action
uah04934  Cushing syndrome
uah04935  Growth hormone synthesis, secretion and action
uah04970  Salivary secretion
uah04971  Gastric acid secretion
uah04972  Pancreatic secretion
uah04976  Bile secretion
uah05032  Morphine addiction
uah05163  Human cytomegalovirus infection
uah05166  Human T-cell leukemia virus 1 infection
uah05200  Pathways in cancer
uah05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113246056 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    113246056 (ADCY4)
   04371 Apelin signaling pathway
    113246056 (ADCY4)
   04020 Calcium signaling pathway
    113246056 (ADCY4)
   04072 Phospholipase D signaling pathway
    113246056 (ADCY4)
   04024 cAMP signaling pathway
    113246056 (ADCY4)
   04022 cGMP-PKG signaling pathway
    113246056 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113246056 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113246056 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113246056 (ADCY4)
   04062 Chemokine signaling pathway
    113246056 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    113246056 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    113246056 (ADCY4)
   04912 GnRH signaling pathway
    113246056 (ADCY4)
   04913 Ovarian steroidogenesis
    113246056 (ADCY4)
   04915 Estrogen signaling pathway
    113246056 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    113246056 (ADCY4)
   04921 Oxytocin signaling pathway
    113246056 (ADCY4)
   04926 Relaxin signaling pathway
    113246056 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    113246056 (ADCY4)
   04918 Thyroid hormone synthesis
    113246056 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    113246056 (ADCY4)
   04916 Melanogenesis
    113246056 (ADCY4)
   04925 Aldosterone synthesis and secretion
    113246056 (ADCY4)
   04927 Cortisol synthesis and secretion
    113246056 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113246056 (ADCY4)
   04270 Vascular smooth muscle contraction
    113246056 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    113246056 (ADCY4)
   04971 Gastric acid secretion
    113246056 (ADCY4)
   04972 Pancreatic secretion
    113246056 (ADCY4)
   04976 Bile secretion
    113246056 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    113246056 (ADCY4)
   04727 GABAergic synapse
    113246056 (ADCY4)
   04725 Cholinergic synapse
    113246056 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    113246056 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    113246056 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    113246056 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    113246056 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    113246056 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    113246056 (ADCY4)
   04714 Thermogenesis
    113246056 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113246056 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    113246056 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    113246056 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113246056 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113246056 (ADCY4)
   05163 Human cytomegalovirus infection
    113246056 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    113246056 (ADCY4)
Enzymes [BR:uah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     113246056 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 113246056
NCBI-ProteinID: XP_026342277
UniProt: A0A3Q7VWK3
Position
Unknown
AA seq 1126 aa
MPTGGGESVGLPPDLPRRGSRCPLLLEHFLGLGWRGDYTQTCAQGRESPEQIGQIWVHSF
LSAFCEAGFFTCFRTPGWCSNSCLTDEKTSSARSRIHKRAIWDLASDRGFLTTVLCALGG
FSLLLGLASREQRLQRWTRPLSVLVWAALLGLGHGFLFTGGLVSAWDQVSFFLFVIFTVY
AMLPLGMRDAAAAGLASSLSHLLALGLYLGPQPDSRPALLPQLAANAVLFLCGNVAGAYH
KALMERALRATFREALRSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQ
GSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKE
HECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHS
GSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAGVYAVEDASMEH
RDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPQMRPSLLMTRYLESWGAAKPF
AHLSHLESPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDEDLDTGDAKFFQVIEQLNSQ
KQWKQSKDFNPLTLYFREKELEKEYRLSALPAFKYYAACTFLVFFSNFIIQMLVANRPPA
LAITYSITFLLFLLLLFVCFSEHLTKCVLKGPKMLHWLPALSGLVATRPGLRVALGTATI
LLVFVMAITSLFFLPAATNCPSRASNVSSVASNVSWELPGSLPLISVPYSMHCCVLGFLS
CSLFLHMSFELKLLLLLLWLGVSCSLFLHSHAWLSDCLIARLYPDPLDSRPGVLKEPKLM
GAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLENVLPAHVA
PQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDE
LLSKPKFSGVEKIKTIGSTYMAATGLNATPGQDAQQDAERSCSHLGTMVEFAVALGSKLD
VINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEE
TARVLQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3381 nt   +upstreamnt  +downstreamnt
atgcccacagggggtggtgaaagtgtagggctcccccctgacctgccacgaagaggttcc
aggtgccccctgctgctggagcacttcttagggctggggtggagaggggattacacccag
acttgtgcccagggcagggaatctcctgagcaaattggccagatttgggtacactcattc
ctaagtgccttctgtgaggcagggtttttcacttgcttcaggaccccaggatggtgctct
aattcctgtttgacagatgagaaaacgagctcagcaaggtcacggattcacaaacgcgcc
atatgggatctagcttcagaccggggcttcctgaccaccgtgctgtgtgcgctcggtggc
ttctcgctgctcctgggcctggcttcccgcgagcaacgactgcagcgctggacacgtccc
ctgtcggtcctcgtgtgggccgcgctactcgggctaggccatggcttcctgttcaccggg
ggcctggtgagcgcctgggaccaggtgtcctttttcctcttcgtcatcttcaccgtgtac
gccatgttgcccttgggcatgcgggatgccgccgccgcgggccttgcctcgtcgctttcc
cacctgctggcccttgggctgtaccttgggcctcagccggactccaggccagcgctgctg
ccgcagctggcagcgaacgccgtgttgttcttgtgcgggaacgtggccggagcgtaccac
aaggcgctgatggagcgcgctctgcgcgccacgttccgggaggctcttcgttccctgcac
tcgcgccggcggctggacacagagaagaagcaccaggaacaccttctcttgtccattctt
cctgcctacctggcccgagagatgaaggcagagatcatggcacggctgcaggctggacag
gggtcccggccagagagcaccaacaacttccacagcctctatgtcaagaggcaccaggga
gtgagcgtgctgtatgctgacatcgtgggcttcacacggctggccagtgagtgctcccct
aaggagctggtgctcatgctcaacgagctcttcggcaagttcgaccagattgccaaggag
catgaatgcatgcggatcaagatcctgggagactgttactactgtgtctctggtctaccg
ctctccctgccagaccacgccatcaactgcgtgcgcatggggctggacatgtgccgggcc
atcaggaaactccgggcggccactggcgtggacatcaacatgcgtgtgggcgtgcattcg
ggcagtgtgctctgcggagtcattgggctgcagaagtggcagtatgatgtctggtcccat
gatgtcacactggccaaccacatggaggcgggcggcgtgccaggacgagtacatattaca
ggggctaccctggccctgctggccggggtctatgctgtggaagatgcatcgatggaacac
cgggacccataccttcgggagctaggggagcccacctacctagtcatcgacccccgggct
gaggaggaggatgagaagggcactgcgggagggctgctgtcctctctcgagggcccccag
atgcgcccatcactgctgatgacccgctacctggagtcctggggcgcggccaagcctttt
gcccatctgagccacctagagagccctgtgtccacttccacccctctcccggagaaggcc
ctggcctccttcagcccccagtggagcctggaccggagccgtaccccccggggactagat
gaggacctggacactggggatgccaagttcttccaggtcatcgaacagctcaactctcag
aagcagtggaagcagtccaaggacttcaacccactgacactgtacttcagagagaaggag
ctggagaaagagtatcgactttctgccctccccgccttcaaatactatgcggcctgcacc
ttcctggtcttcttctccaacttcatcatccagatgctggtggccaacaggccgccagct
ctggccatcacctatagcatcaccttcctcctcttcctcctcctcctcttcgtctgcttc
tcagagcacctgacgaagtgtgtcttgaaaggccccaagatgctgcactggctgcccgca
ctgtctggcttggtggccacacggcccggactccgagttgccctgggcactgccaccatc
ctcctcgtttttgtcatggctattaccagcctgttcttcttaccggcggcaacaaactgc
ccttcccgggcttccaatgtgtcctccgtggcttccaacgtctcctgggagctccctggc
tccctgcctctcatcagcgtcccatactctatgcactgctgcgtgctggggttcctgtcc
tgctccctctttctgcacatgagcttcgagctgaagttgctgctgctcctgctatggctg
ggggtctcctgctccctcttcctgcactcccacgcctggctgtccgactgcctcatcgcc
cgcctctatccagatcccttggactccaggccaggggtgctgaaggagcccaaactgatg
ggagctatctccttcttcatcttcttcttcaccctccttgtcctggctcggcagaatgag
tactactgccgcctggacttcctgtggaagaagaagctgcggcaggagcaggaggagaca
gagaccatggagaacctgactcggctgctgctggagaatgtgctccctgcgcacgtggcc
ccccagttcattggccagaaccggcgcaacgaggacctctaccaccagtcctacgagtgt
gtctgtgtcctcttcgcctcagttccagactttaaggagttttactctgaatctaacatc
aaccacgagggtctagagtgtctgcggttgctcaatgagatcatcgctgattttgatgag
ctgctctcaaagcccaagtttagcggcgtggagaagatcaaaaccatcggcagcacctac
atggcagccacgggcttaaatgccacccccggacaggacgcacagcaggatgccgagcga
agctgcagccacctgggcaccatggtggagttcgcagtggccctcggatcgaagctggat
gtcatcaacaagcactcattcaacaacttccgcctgcgtgtggggttgaaccacggacct
gtagtggctggagtgattggggcccagaagcctcagtatgacatctggggcaacacggtg
aacgtggccagccgcatggaaagtacgggagtcctgggcaagatccaagtgactgaagag
acagcccgggtgctgcagtccttaggctatacctgctacagccggggcatcatcaaggtc
aaaggcaaagggcagctgtgcacctacttcctgaacacagatttgacacgaactggccct
ccctcggccaccctaggctga

DBGET integrated database retrieval system