KEGG   Ursus arctos horribilis: 113246351
Entry
113246351         CDS       T05909                                 

Definition
(RefSeq) A-kinase anchor protein 5-like
  KO
K16522  A-kinase anchor protein 5
Organism
uah  Ursus arctos horribilis
Brite
KEGG Orthology (KO) [BR:uah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uah01009]
    113246351
Protein phosphatases and associated proteins [BR:uah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     113246351
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 113246351
NCBI-ProteinID: XP_026342731
UniProt: A0A3Q7URC3
Position
Unknown
AA seq 424 aa
METTVSEIQVESKDEKRPTEVSPQDERQEERASVLCFKRRKKATKAMKPKASSEAAGTAR
KCPPEAGASDQPQPPGGAWASIKRLVTRRKRSESSKQQKPFEAKVQPEISAEDADVSKKK
AKSGLKIPCIKFSKGEKRSNHSKIIEDSDCSIRVQGEAEHLDTKDDQAAKTQLPQDVSKD
VSQKGGDEVCEPDVSNSTTTAGEKVISVELGLDTGHSAIHPGTLILERDTETIEEKQSVQ
GQQVSPLETSETEPQPPVVSEVPPPPASPDQQIVEDARSNILESGPNWKEHESREMIAEE
SELKDTELRQESELRENEVTAEKPKSEESKRMEPIAIIITDTEISEFDVKKSKNVPKQFL
ISIENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDNKMN
NLLQ
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggaaaccacggtttccgaaattcaagttgaaagcaaggatgagaagagacccacagaa
gttagtcctcaagatgagaggcaggaggaaagagcatcagtgctttgcttcaagagaaga
aagaaagcaaccaaagcaatgaagcccaaagctagctctgaagctgctggtacagcaaga
aagtgtcccccagaagcaggagcttcagatcagccacagcccccagggggggcctgggcc
tcaatcaaacgtctggtgacacgcaggaaaaggtcagaatcttcaaagcagcaaaagccc
tttgaggctaaagtgcagcctgaaatcagtgctgaggatgctgatgtttctaagaaaaag
gcaaaatccggacttaagattccctgcataaaattctcaaaaggagagaaaagaagtaat
cattccaaaatcatagaagactcagactgcagcatcagagtccagggagaggctgaacac
ttggatacaaaagatgaccaggcagcaaagacccagttgccccaggatgtaagtaaagat
gtctcacagaaagggggtgatgaggtctgtgaaccagatgtgagcaacagcacaactaca
gctggagagaaagtgatttcagtagaacttgggttagatacagggcattctgccattcac
ccgggaacactaatccttgaaagagataccgaaacgattgaggaaaaacaaagtgtccaa
ggccagcaagtaagcccacttgaaacttcagaaacagaacctcagccaccagtggtttct
gaggttcctcccccacctgcaagcccagatcagcaaattgtagaagacgccagaagcaat
atcctcgaaagtggaccaaattggaaagagcatgaaagtagagagatgatagctgaagag
agtgagctgaaagatactgaattgcgccaggaatcagagctgagagaaaatgaggtcact
gcagagaaacccaaatcagaagaaagcaaaagaatggagccaattgctattattattaca
gacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccctaagcaattctta
atttcaattgaaaatgagcaagtaggggtttttgctaatgatagtggttttgagggtaga
acttcagaacaatacgaaacactcttaatagaaacagcttcttctcttgtcaagaatgct
atccaattgtctatagaacagctggttaatgaaatggcctctgatgataataaaatgaac
aatcttctacagtga

DBGET integrated database retrieval system