KEGG   Ursus arctos horribilis: 113247030Help
Entry
113247030         CDS       T05909                                 

Gene name
GGT5
Definition
(RefSeq) glutathione hydrolase 5 proenzyme isoform X1
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
uah  Ursus arctos horribilis
Pathway
uah00430  Taurine and hypotaurine metabolism
uah00480  Glutathione metabolism
uah00590  Arachidonic acid metabolism
uah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    113247030 (GGT5)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    113247030 (GGT5)
   00480 Glutathione metabolism
    113247030 (GGT5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:uah01002]
    113247030 (GGT5)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:uah04090]
    113247030 (GGT5)
Enzymes [BR:uah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     113247030 (GGT5)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     113247030 (GGT5)
    3.4.19.14  leukotriene-C4 hydrolase
     113247030 (GGT5)
Peptidases and inhibitors [BR:uah01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   113247030 (GGT5)
CD molecules [BR:uah04090]
 Proteins
  113247030 (GGT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 113247030
NCBI-ProteinID: XP_026343620
UniProt: A0A3Q7UU57
Position
Unknown
AA seq 611 aa AA seqDB search
MSSCLDCQSVCLSLASIYLLICPITIFLCIHPPICLCTCLLSPLRASEPWPKAAGPRSAW
CCWGWGWPWPLSCLPWSSPAATPAAAPRPLPTLRLLLTPRSARTLDEPSSSSMAHLWMLP
LRLWSALESSTLRAWAWAEGLSSPSTMQPRGRWKSSMPGRQCPPTTSRVCWTSVSRPSHW
AQGPSGSECRGNSVAMPRPTAAMAACPGHNCSSPPSPCSEGTTTCPPSSVSSCRVTSYGL
PCPRRPSEPLRAQDPFPWPALAATLETVATEGAEAFYTGTLGQMLLEDIADQGSGLTPQD
LASFQAEVVEALEMPLGDYTLYSPPPPAGGAILSLILNVLQGFNFSSESVARSEGSVNLY
HHLVETLKFAGGQRWRLWDPRSHLDIQNVSQDLLGEALAQHIRRQIDARGDHQPSHYSLA
GAWGHKMGTSHVSVLGEDGSAVAATSTINTPFGAMLYSPRTGILLNNELLDLCWRRPPGS
KVTPQPVPGERPPSSMVPSILVNTAQGSKLVIGGAGGELIISAVAQAIINKLWLGFDLST
AIAAPILHVTSKGHVEYEPRFSQEVQKGLQARGHNQTKSPFFLNVVQAVSQDGACVYAAA
DPRKGGEASGY
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctgtctagactgtcaatccgtttgtctgtctctggcttccatctatttgctc
atctgtccaatcaccatcttcttgtgcattcatccaccaatctgtctgtgcacctgcctt
ctctctccactccgggcctcagagccatggcccaaggccgcagggccacggtcagcatgg
tgctgctggggttggggctggccctggccattgtcgtgcctgccgtggtcctctcccgcc
gccacaccagctgcggcccccaggcctttgcccacgctgcggttgctgctgactccaagg
tctgctcggacattggacgagccatcctccagcagcatggctcacctgtggatgctgcca
ttgcggctctggtctgcactggagtcgtcaaccctcagagcatgggcctgggcggagggg
ttatcttcaccatctacaatgcaaccacggggaaggtggaagtcatcaatgccagggaga
cagtgcccaccaactacgtcccgggtctgctggaccagtgtgagcaggcccagccactgg
gcacaggggcccagtggatcggagtgccgggggaactccgtggctatgccgaggcccacc
gccgccatggccgcctgccctgggcacaactgttccagcccaccatctccctgctccgag
gggactaccacgtgccctccatcctcagtcagttcctgcagagtgacttcctacggcctt
ccttgtccaagacgtccctcagaacccctgagggctcaggacccattcccctggcccgca
cttgccgccaccctggaaaccgtggccacggagggggcagaggctttctacacagggaca
ctgggccagatgctgctggaggacattgccgatcaaggcagcgggctgaccccgcaggac
ctggcatcatttcaggcggaggtagtggaggccctggagatgcccctgggggactacacc
ctgtactcaccgccaccacctgcagggggcgcgattctcagcctcatcctcaacgtgctc
caagggttcaacttctcctcggagtcggtggccaggtccgaggggagtgtgaacttgtac
catcaccttgtggagacgctcaagtttgccgggggacagaggtggcggctgtgggacccc
cgcagccacctggatatccagaacgtctcccaggacctgctgggagaggctttggcccag
catatccgccggcagatcgacgctcggggtgaccaccagcctagccactacagcctggcc
ggggcctggggccacaagatgggcacgtcgcacgtgtctgtgctgggggaggacggcagc
gctgtggcggccaccagcaccatcaacacgcccttcggggcaatgctgtactcaccgcgc
acgggcatcctcctcaacaacgagcttctggacctatgctggaggcgccccccgggctcc
aaagtcaccccccaacccgttccaggcgagcggcctccatcatccatggttccttccatc
ttggtcaacacagcccaggggtcaaagctggtgattggtggggctggtggggagctcatc
atctctgctgtggcccaggccatcataaacaagctgtggcttggctttgacctgagcact
gccattgcagcccccatcctgcacgtcaccagcaagggccatgtggagtacgagccccgc
ttcagccaggaggtgcagaaggggctccaggccaggggccacaaccaaaccaagagtccc
tttttcctgaatgtggtccaggctgtgtcccaggacggggcctgtgtgtatgccgcagcg
gacccgaggaaaggtggggaggcctcaggctactga

DBGET integrated database retrieval system