KEGG   Ursus arctos horribilis: 113247831Help
Entry
113247831         CDS       T05909                                 

Gene name
G6PD
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase isoform X1
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
uah  Ursus arctos horribilis
Pathway
uah00030  Pentose phosphate pathway
uah00480  Glutathione metabolism
uah01100  Metabolic pathways
uah01200  Carbon metabolism
uah05230  Central carbon metabolism in cancer
Module
uah_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
uah_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    113247831 (G6PD)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113247831 (G6PD)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    113247831 (G6PD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uah04147]
    113247831 (G6PD)
Enzymes [BR:uah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     113247831 (G6PD)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     113247831 (G6PD)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   113247831 (G6PD)
  Exosomal proteins of colorectal cancer cells
   113247831 (G6PD)
  Exosomal proteins of bladder cancer cells
   113247831 (G6PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 113247831
NCBI-ProteinID: XP_026344934
UniProt: A0A3Q7VQA1
Position
Unknown
AA seq 555 aa AA seqDB search
MGTRANGAKLHADARGTEDVAQQRRGEKAPGSRAVRAESIMAEQVALSRTQVCGILREEL
YQGNAFHQSDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPEDTFIVGYARSRLTVADI
RKQSEPFFKATPEEKPKLEEFFARNSYVAGQYDDTASYERLNSHMNALHQGPQTNRLFYL
ALPPTVYEAVTKNIHETCMSQTGWNRVIVEKPFGRDLQSSDRLSNHISSLFREDQIYRID
HYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVM
QNHLLQMLCLVAMEKPASTDSDDVRDEKVKVLKCISEVQADNVVLGQYVGNPSGEGESTK
GYLDDPTVPRGSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQFRDVAGDI
FQQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERL
ILDVFCGNQMHFVRSDELREAWRIFTPLLHKIEREKLQPIPYVYGSRGPAEADELMKRVG
FQYEGTYKWVNPHKL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggtacgcgagcgaacggtgcaaagctgcatgcagacgcgcgtggcaccgaggacgtg
gcgcagcagcggcggggagagaaggcgcccggcagccgggccgtccgcgcagagagcatc
atggcagagcaggtggccctgagccggacccaggtttgcgggatccttcgggaagagctg
taccagggcaatgccttccatcaatccgatacacatatcttcatcatcatgggtgcatcg
ggcgacctggccaagaagaagatctaccccaccatctggtggctgttccgggatggcctt
ctgcccgaagacaccttcatcgtgggctatgcccgctcccgcctcacagtggctgacatc
cggaaacagagcgagcccttcttcaaagccacaccagaggagaagcccaagctggaggag
ttctttgcccgcaactcctatgtggctggccagtatgacgacacggcctcctacgagcgc
ctcaacagccacatgaatgccctccaccaggggccacagaccaaccgcctcttttacctg
gccttgccccccacagtctacgaagcggtcaccaagaacatccacgagacctgcatgagc
cagacaggctggaaccgtgtcattgtggagaagcccttcgggagggacctgcagagctcc
gacaggctgtccaaccacatctcttccttgttccgtgaggaccagatctaccgcatcgac
cactacctgggcaaggagatggtccagaacctcatggtgctgaggtttgccaacaggatc
ttcggccccatctggaaccgggacaacattgcctgtgtcatcctcactttcaaggagccc
tttggcactgagggccgtgggggttacttcgatgaatttgggatcatccgggacgtgatg
cagaaccacctcctgcagatgctctgtctggtggccatggagaagcccgcctccacagac
tcggacgacgtccgtgacgagaaggtcaaggtgttaaaatgtatctcagaggtgcaagca
gataacgtggtcctgggccagtatgtggggaaccccagcggagagggggagtccaccaaa
gggtacctggatgaccccacagtaccccgtgggtccaccactgcgacctttgcagccgtc
gtcctttatgtggagaacgagaggtgggacggggtgcccttcatcctgcgctgcgggaaa
gcactgaacgagcgcaaggccgaggtgcggctgcagttccgcgacgtggccggcgacatc
ttccagcagcagtgcaagcgcaatgagctggtgatccgcgtgcagcccaacgaggccgtg
tacaccaagatgatgaccaagaaacccggcatgttcttcaaccctgaggagtccgagctc
gacctgacgtacggcaacagatacaagaacgtgaagctccccgatgcctacgagcgcctc
atcctggacgtcttctgcgggaaccagatgcacttcgtgcgcagtgacgagctccgggaa
gcctggcggatctttacgccgctgttgcacaagattgagcgtgagaagctccagcctatc
ccttatgtttacggcagccgaggccccgcggaggcagatgagctgatgaagagagtgggc
ttccagtacgagggcacctacaagtgggtgaacccccacaagctctga

DBGET integrated database retrieval system