KEGG   Ursus arctos horribilis: 113250623Help
Entry
113250623         CDS       T05909                                 

Gene name
MARS2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
uah  Ursus arctos horribilis
Pathway
uah00450  Selenocompound metabolism
uah00970  Aminoacyl-tRNA biosynthesis
uah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    113250623 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    113250623 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:uah01007]
    113250623 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:uah03016]
    113250623 (MARS2)
Enzymes [BR:uah01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     113250623 (MARS2)
Amino acid related enzymes [BR:uah01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   113250623 (MARS2)
Transfer RNA biogenesis [BR:uah03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    113250623 (MARS2)
 Prokaryotic type
   Other AARSs
    113250623 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DUF5600
Motif
Other DBs
NCBI-GeneID: 113250623
NCBI-ProteinID: XP_026348033
UniProt: A0A3Q7WCI1
Position
Unknown
AA seq 593 aa AA seqDB search
MLRISVLRLLGRPGTSGVSLLEYISSRHYSSGPLGARDDIRGARAFFTTPIFYVNAAPHI
GHLYSALLADALCRHRRLRVPSAAATRFSTGTDEHGLKIQQAAAAAGLAPTELCDRVSAQ
FRQLFREAGISSTDFIRTTETRHRIAVQHFWGLLKARGLLYKGLYEGWYCASEECFLPEA
KVTRQSDSSGDSCHVSLESGHPVSWTKEENYIFRLSQFREPLQRWLRGDPQAIAPEPFHR
AVLQWLEEELPDLSVSRKSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVIGYPNAEFKSW
WPTTSHIIGKDILKFHAIYWPALLLGAGMSPPHRIYVHSHWTVCGQKMSKSLGNVVDPRT
CLDRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELADALGGLLNRCTAKRINPSGT
YPVFCTTCFPSEPGLVGPSVRAQAEDYALVNAVATLPRQVADHYDNFQIYKALEAVSSCV
RQTNGFVQRHAPWRLNWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLG
VSATERGLGELCFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRAWLVKAHRT
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatttctgtcctgcggctgctaggacgtccgggaaccagtggagtctcgctt
ctggagtacattagctcacgccactacagttcgggccctctcggcgcccgcgacgatatt
cgcggcgctcgcgccttcttcacgacacccattttctacgtgaacgcggcgccgcacatt
ggacacctgtactcggcgctactggctgacgccctgtgccgccaccgtcgcctccgagtt
cccagcgctgccgccacgcgcttctccactggcacagacgagcatggcctgaagattcag
caagcagcagccgctgcgggcctggctcccaccgaactgtgcgaccgagtatctgcccag
ttccggcagctttttcgggaggctggcatctcctccaccgactttatccgcaccaccgaa
acccggcaccggatcgctgtgcagcatttctggggactgctgaaggcccggggtctgctc
tacaagggactctatgaaggttggtattgcgcctccgaagagtgcttcctgcctgaggcc
aaggtcacccggcagtcggattcatcaggggattcgtgtcatgtatctctagagagtggg
catcccgtatcctggaccaaggaagaaaactacattttcaggctttctcagttccgagag
ccgcttcagcggtggctgcggggcgaccctcaggcaatcgctcccgagccttttcatcgc
gcggttcttcagtggctggaggaggagctgccggacctgtctgtctctcgaaagagcagt
cacttacattggggcattcctgtgcccggggacgattctcagaccatctacgtatggcta
gatgccttggtcaactaccttactgtaattggctacccaaatgctgagtttaaatcttgg
tggccaaccacctctcatatcataggcaaggacattcttaaattccatgctatctattgg
cctgccctcctcttgggggccggcatgagcccaccacaccgcatctatgtccactctcac
tggacggtctgtggccaaaagatgtccaaaagcttgggtaacgtggtggatcccaggact
tgccttgatcgctatactgtggatggcttccgatactttcttctccggcagggcgtcccc
aactgggattgtgattactatgatgaaaaggtggttaagttgctagattctgagctggca
gatgctttgggaggtctcctgaaccggtgcactgccaaaagaataaatccttctgggacc
tatccggttttctgcactacctgctttcccagtgagccagggttggtgggaccatcagtt
cgtgctcaggcagaggactatgctttggtgaacgcagtggccactttgcccaggcaggta
gctgaccactatgataactttcagatctataaggctctggaggcagtgtccagctgtgtc
cggcaaactaatggctttgtccaaaggcatgcaccatggaggttgaactgggagagccca
gtggatgccccctggctgggtactgtacttcatgtggccttggaatgtttgcgagtcttt
ggaactttgctccagcctgtcaccccaagcctagccgataagctgctatccaggttgggg
gtctctgctacggagaggggccttggagagctctgtttcttgcctcgattctatggacat
ccatgtccttttgaagggaggaggctgggacctgaaactgggctcttgtttccaagacta
gaccagtccagggcctggctagtaaaagcccataggacctag

DBGET integrated database retrieval system