KEGG   Ursus arctos horribilis: 113250712Help
Entry
113250712         CDS       T05909                                 

Gene name
TTN
Definition
(RefSeq) titin isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah05410  Hypertrophic cardiomyopathy (HCM)
uah05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:uah00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    113250712 (TTN)
   05414 Dilated cardiomyopathy (DCM)
    113250712 (TTN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113250712 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113250712 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:uah04812]
    113250712 (TTN)
   04147 Exosome [BR:uah04147]
    113250712 (TTN)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113250712 (TTN)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   113250712 (TTN)
Membrane trafficking [BR:uah04131]
 Others
  Actin-binding proteins
   Others
    113250712 (TTN)
Cytoskeleton proteins [BR:uah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     113250712 (TTN)
Exosome [BR:uah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113250712 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Ig_6 Pkinase Titin_Z fn3_4 C1-set Pkinase_Tyr SusE Ig_4 PPAK Izumo-Ig Adeno_E3_CR1 THB
Motif
Other DBs
NCBI-GeneID: 113250712
NCBI-ProteinID: XP_026348213
UniProt: A0A3Q7VGK5
Position
Unknown
AA seq 34350 aa AA seqDB search
MTTQAPTFQQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQAISTSTLPGVQISFSD
GRARLTIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEVVPAKKTKTIVSTAQISETRETRIEKKIEAHFDARSIATVEMV
IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAGRISTSPIRSVKSPLLARKTQTPGMAPGPEVPPPWKQEGYVASSEAEMRE
TTVTSATQIRTEERWEGRYGIQEQVTVSGGAGAAASVSASAAFAAGAVAAGAAEARQETD
KSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAMHVQPAQEQIKKEAEKKTAVTKAV
VAADKEQELKSRTREVITTKQEQVHVTHEQIRKETEKAFVPKVIISATKAKEQETRVTGQ
ITTKQEQKQVTQETIRQTAMTAAASMVVAATAETTKLETILGAQEEIATHHDQMHITQEK
ITKETRKTVVPKVIVATPKVKEQDLVSRTREGITTKREQVQITQEKMRKEAEKTALSTIA
VATAQVAQEQETILRTREGMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARIREPRE
PRHLEESYAQQTTMEYGYKEHISATKVAEQPQRPASEPHVVPKAVKPRVIQAPSETHITT
TDQMGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAI
ATLQKELSATSSAQKITKSVKAPTVKPAEARVRAEPTPSPQFPFADTPDTYKSQAGIEVK
KEVGVSIAGGTVREERFKVLHERETKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGES
VTLECHISGYPSPKVTWYREDYQIESSIDFQITFQNGIARLMIREAFAEDSGRFTCSAVN
EAGTVSTSCYLAVQASEEFEKETTVTEKLTTEEKRFVESRDVVMTDTSITEEQAGPGEPA
APFFITKPVVQKLVEGGSIVFECQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECR
LVISMTFADDAGEYTIVIRNKHGETSASASLLEEAEYESLMKSQQEMLYQTQMTAFVQEP
KVGEIAPGFLYSDYEKEYEKEQALIRKKMAKDTVMVRTFVEEQEFHISSFEERLIKEIEY
RIIKTTLEELLEEDGEEKMAVDISESEAIEAGFDLRIKNYRILEGMGVTFHCKMSGYPLP
KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNMKGNAICSGKLY
VEPAAPLAAPTYIPTPEPVSRIRSISPRSVSRSPIRMSPARMSPARMSPARMSPARMSPG
RRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVND
YTHKVVIKEDGTQSLIIVPAAPSDSGEWTVVAQNRAGKSSISVILTVEAVEHQVKPMFIE
KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDST
VSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPL
HLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH
DGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL
VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEGETARF
RCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGV
IEHKVKLEIQQREDFRSVLRRAPEPKPEFHIHEPGKLQFEVQKVDRPVDTTEAKEVVKLK
RAERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLH
WTKELTEEEKKVLAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVR
VVGRPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET
SSHAFLLVQAKQSIIFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGVEVHTGDKY
RMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPE
SFSGELECVISPENIEGKWYHNGVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVV
DGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGQEVQPSDR
VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPSLGLSTSGRVSVYSVDVITPLKDVNVLEGT
KAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLMVG
RVETSCDLSVEKIKIIRGLRDLTCTETQNVVLEVELSHSGIDVLWNFKDQEIKPSSKYKI
EAHGKIYKLTVLNMMKDDEGEYTFFAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFE
CEVANPDSEGEWLKDGKHLPLSNNVRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSA
KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLRSNDKYDISVKGT
VYTLRIKNCAVVDESVYGFKLGKLGASARLHVETVKIIKKPKDVTALENSTVAFEVSVSH
DTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQHISPSDAGEYTAVVGQLECRAKLFVE
TLHITKTMKNIEVPETKSASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLII
MNTSTEDSAEYTFVCGNDQVSATLRVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK
WLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAAEYTFVAGKATSTATLYVEARHIEF
RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDGQELPTVDRIKIQKEKYVHRLLIPSTR
MSDAGQYAVVAGGNISTANLYVEGRDVRIRSLKREVQVIEKQRAVVEFEVNEDDVDAHWY
KDGIEINFQIQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVTLYVNAPEPPQ
ILQELQPITVQSGKPARFCAVIAGRPQPKIAWYKEEQLLSTGFKCKFLHDGQEYTLLLIE
AFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAVITPLQDTVTSEGQ
PARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGLYTFVANN
AMGQVSSTANLRLAAPESILHGRIEEQIEVEMKEFSSSLLSAEEEGFQTYSSGLQLSNRN
ETLELSSELPVQSTTFDSKKEGRVPIFIKEASNAEISVGDVAKLSVTVTGIPKPKIQWFF
NGVMLTPSADYKFVFDGNDHSLIILFTQFEDEGEYTCIASNEYGQTVCSAYLKISSKGEA
HKEKEPEPVEKNLEKFEGPCPPYFLKEFKPIHCAQGLPAVFEYKVLGEPAPTVLWFKENK
QLYTNVYYTIIHNPDGSGTFIVNDPQREDSGLYVCKAENMWGESTCAAELLVLLEDTDKP
DAPCEAEPTPEATKDFPQMSLKGPAVEAFDSEQEIAAFVNDTILKAASIAEENQQLSYEH
IIKTSELSSQVTLVAEQLQSTVMLEQNVPDPESTRALLSINGTIHVRPIKEPSPNLQLQI
VQSQKTLPKEDVLMLQEPESQVVLSDTEKIFPSAMSIEEISSLMVEPLKTFLAEPEGSYP
QSSIEEAPAHSYPTSVAEEVLSSREKTASAMDKEQRLTLPKQEAQSALTLSQSLAEGSME
SRKGPEVKPQVPSEHTCTEDEILMESADQLESAGQDFAARTEEGKSLRFPLACEEKQVLL
KEECSDHLAVPLNQTSEYKKEPMMINGVQEVQTSDTLPKESLLPGIPEEQRLNLKTQIRR
ALQAAVASEQPSLFSEWLRNVEKVEVKAINFTQEPRRILCTYLITSVKTLTEEFTIAIEG
IDPQTANLKTELKDALCSIVCEEINVLTAEDPRIQKGGFQEEPGPFLDSQKVEAIWEPEV
ESKHLVSAEEVSYVHVESQVKVADTTPVPDGVALAASPEEKQGETPKPSEAREKSSGSGT
GEVGLGELQEAEGSLAEEDGPVIHTPLVDTTAEEGDIVNLTTFITNAKEVNWYFEGKLVH
SDEKFKCLQDQNTYTLVIDKVNTEEHQGAYTCEALNDKGNAATSAKLTVVKRAAPVIKRR
IEPLEVALGHLAKFTCEVQTAPNVRFQWFKAGREIYESDKCSIRSSKYVSTLEILRTQVV
DCGEYTCKASNEYGSVSCTATLTVTEAYPPSFYSRPKSVTTFVGKTAKFLCTVLGTPVIE
TIWQKDGAALSPSPNRKISEAENKHSLELSNLTIQDRGVYSCKASNKFGADICQAELIII
DKPHFIKELEPVQSAINKKIHLECQVDEDRKVTVTWNKDGQKLPPGKDYKIYFEDKIASL
EIPLAKLKDSGTYVCTASNEAGSSSSSATVTIREPPSFVKKVDPSYLMLPGESARLHCKL
KGSPVIQVTWFKNNKELSESNTIRMSFVNSEAVLDLTDVKVEDSGSYSCEAVNDVGSDSC
SAEIVIKEPPSFIKTLEPADIVRGTNALLRCEISGTGPFEISWFKDKKQIRSSKKYRLFS
QKSLVSLEIFSFNSADVGEYECVVANEVGKCGCSATHLLKEPPTFVKKVDDFTALAGQTV
TLQAAVRGSEPISVTWFKGQEIIKEDGKIKMSFSNGVAVLIIPDVQISFGDKYTCLAENE
AGSQTSVGELIVKEPAKIVERAELIQVTAGDPATLEYTVTGTPELKPKWYKDGRPLVASK
KYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRN
VGSVVNSTCRLDCRVAGSLPMRVSWFKDGREIASSDKYRIAFVEGTASLEISRVDMNDAG
NFTCRATNSVGSKDSSGALIVQEPPSFVTKPASKDVLPGSAVCLKSTFQGSTPFTVKWFK
GAKELVSGGSCYISKEALESSLELYAVKTSDSGTYTCQVSNVAGSVECSANLFVKEPATF
VERLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHKMTFVESTAVLRLTD
VAIEDSGEYMCEAQNEAGSDHCGSILIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPP
FEITWFKDNTTLRSGRKYKTFIQDQLVSLQILKFVATDAGEYQCRVTNEVGSSTCTARVT
LREPPAFVKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDNEEITEDDNIRMTFENNVA
SLYLSGIEVKHDGKYVCQARNDAGIHRCSALLSVKEPATITEEAVSIDVTQGDPATLQVK
FSGTKELTARWFKDGQELTLGQKYKISVTDTVSVLKIISTEKRDSGEYTFEVQNDVGRSS
CKASINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEITASEKY
KFSFHDNTAFLEISHLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFMEKPQSQDVSP
HTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTILELFSAKAADSGTYICQ
LSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPEIRVSWYLDGNE
ITAIKKYGISFIDGVATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIREL
RPVEVVKDSDVQLECEVAGTSPFEVTWLRNNKEIRSSKKYTLTDRVSVFNLHITRCDPSD
TGEYQCIVSNEGGSCSSSTRVSLKEPPSFMKKIENLTTVLKSSATFQSTVAGSPPISITW
LKDDHILDEDDNVHISFVNNVATLQIRAVDNGHSGRYTCQAKNESGVERCYAFLLVQEPA
QILEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQ
SVMKQDSGQYTFKVENDFGSSSCDAHLRVLDQDIPPSFTKKLTKMDKVLGSSIRMECKVS
GSLPISAQWFKDGKEISTSAKYRPISHENTVSLEVNNLELEDTANYTCKVSNVAGDDACS
GILTVKEPPSFLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWFKDDVELASGPKCFIGLE
GSTSFLNLYSVDASKTGQYTCQVTNDVGSDSCTTVLLVTEPPKFVKKLETSKIVKAGDST
RLECKITGSPEIRVVWYRNEHELHASDKYRMTFIDSVAVLQMNNLGTEDSGDFICEAQNP
AGSTSCSTKVIVKEPPVFSSFPPVVETLKNTEVSLECELSGTPPFGVIWYKDKRQLRSSK
KYKIASKNFHASIHILNVEASDIGEYYCKAQNEVGSDTCICTVKLKEPPRFVSKLNSLTV
VAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKY
ICQIKNDGGMRENMATLTVLEPAVIVEKAGSMTVAVGETCTLECKVAGTPELSVEWYKDG
KLLTSSQKHKFSFYNKISSLKILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPPS
FTRRLRGTVGVLGTSCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNS
LDSSDTGNYTCVAANAAGSDECRAALAVQEPPSFVKEPEPLEILPGKNVTFTSVIRGTPP
FKVGWFRGARELVRGDRCNIYFEDTVAELELFNVDISQSGEYTCVVSNNAGQTSCTTHLF
VKEPATFVKKLSDHSVEPGKSIILEGTYTGTLPISVAWKKDGVNVTPSERCSIVTTEKTC
ILEILNSTKRDAGQYSCEIENEAGRDVCQALVSTLEPPYFVTELEPLEASVGDSVSLQCQ
VAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTAS
SKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENL
QTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSID
VIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQY
TCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVVKQGESIQLECKISGSPEIKVVWFRN
DSELHESWKYNMSFVNSVALLTINEGSTEDSGDYICEAHNGVGDASCSTALTVKAPPVFT
QKPAPIGALKGSDVIFQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHILNLD
TSDVGEYHCKATNEVGSDTCVCTVKFKEPPRFVKKLSDTSTLVGDAVELRAVVEGFQPIS
VVWLKDKGDVIRESENTRISFVDNVATLQLGSPEASDSGKYVCQIKNDAGMRECSAVLTV
VEPARIVEKPEPMTVTTGNPFALECVVAGTPELSVKWFKDGRELSADSKHQITFINKVAS
IKIPCAEMSDKGLYSFEVKNSVGKSTCSVSVHVSDRVVPPSFIRKLKDMNAILGTSAVLE
CRVSGSAPISVGWFQDGNELVSGPKCQSSFSENVCTLNLSLLEPSDTGVYTCVAANVAGS
DECSAVLTVQEPPSFEQIPDSVEVLPGTSLIFTSVFRGTPPFKVKWFKGSRELVSGESCT
ISLEDFVTELELLEVEPLQSGDYSCLVTNDAGSASCTAHLFVKEPATFVKRLADFNVETG
SPIVLEATFTGTPPISVSWMKNEFLLSQSQNCSITMTEKSTILEITESTIEDYAQYSCLI
ENEAGQDICEALVSVLEPPYFIEPLQHVEATIGEPTTLQCKVDGTPEIRISWYKEHTKLR
SAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSGVLVIKERKLPPSFARK
LKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQS
HVGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPI
KITWAKDNREIRPGGNYKMTLVENTATLTVLKVSKGDAGQYTCYASNVAGKDSCSAHLGV
QEPPRFIKKLETSRIVKQDEYTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFLDSVA
VLEMHNLSVEDSGDYTCEARNAAGSASSSTSLKVKEPPVFRKKPHPVETLKGADVHLECE
LQGTPPFQVSWHKDKRELRSGKKYKIMSENFLTSIHILNVDAADMGEYQCKATNDVGSDT
CVGSITLKAPPRFVKKLSDVSTIVGEEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWV
SYSENIATLQFARAETANAGKYTCQIKNDAGMQECFATLSVLEPAAIVEKPESIRVTTGD
TCTLECTVTGTPELSTRWFKDGKELTSDSKYKISFFNKVSGLKIINVAPSDSGVYSFEVQ
NPVGKDSCTASVQVSDRAVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNE
ISSGRKYQTTLTDNTCALTVNMLEESDAGDYTCVATNVAGSDECSAPLTVREPPSFVQKP
EAMDVLTGANVTFTSIIKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVETTQ
SGEYTCIVSNEAGRASCTAHLYVKAPAKFVKRLNDYSIEKGKPLILEGTYTGTPPISVTW
KKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPP
YFVKQLEPVKVTVGDSASLQCQIAGTPEIGVSWYKGDTKLRPTSTCKMHFRNNVATLVFN
QVDGSDSGEYICRAENSVGEVSSSTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFECTIH
GSEPISVSWYKDGKPLKDSPNVQTSFLDNVATLNIFKTDRSLAGQYSCTATNPIGSASSG
ARLILTVGKNPPFFDIPVAPVDAVVGDSADFECHVTGTQPIKVAWAKDNREIRSGGNYQI
SYLENTAHLTILKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKKLSETVEE
TEGNSFRLEGRVAGSQPITVAWYRNNIELHPTSNCEIAFKNNTLLLHVKKAGMGDAGLYT
CKVSNDAGYALCTSSIVIKEPKKPPVFDQHLTPVTAIEGEFVQLSCHVWGSEPIRIQWLK
AGREVKPSDRCSFSFAHGTAMLELKDVAKADSGDYVCKASNVAGSDTSKSKVTIKDKPAA
VPAAKKAAVDGKLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRI
LIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKLEGDLRAML
KKTPILKKGAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEET
HRLEIEEIEKSEKDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDDDAVFEIDIKI
NYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLT
VIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHKVHKL
TIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDD
AIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAEL
YLTTKEIKLEMKPPDIPDSRVPIPTMPIRAVPPEEIPPMVVPPIPLLLPSPEEKKPPAKR
IEVTKKAVKKDTKKVVAKPKEEPKEVDKKPLRPTALIPAKAPEIVDVSSKAEEVKITTIT
RKKEVHKEQEAVYEKKRAVYEEKKLFIESLEEPYDELEVEPYTEPYEEPYYEEPDEDYEE
AKVEAKREVHEEWEEDFEEGQEYYEREEGYDEGEEDWEETYQEREVVQVQKEVYEEAHER
KIPAKVPEKKAPPPKVVKKPVVEKIEKTSRRVEEQKVQVTKVPEVSKKIVPQKPSRTPVQ
EEVIEVKVPAVHTKKMVISEEKMFFASHAEEEVSVTVPEVQKKTVTEEKIHVAVSKKIEP
PPEVPELPKKPVPEEVVAVPIPKKVEPPPAKVPEVPKKPVPEEKKPVPVPKKEPPAPPKV
PEVPKKPVPEEKIPVPEEKIPVPVAKKKEVPPAKVPEVQKKVVTEEKITIVTQREESPPP
AVPEIPKKKVPEEKRPVPQKEEEVPPPKGIVSLSKTKPVPEEKVPVPVPVAKKAPPPRAE
VSKKTVVEEKRFAAEERLSVAVPQTVEVMRHEVSTEEEWSYSEEEERVSVSVYREEEREE
EEEVKVTEYEVMEEPEEYVVEEKVHFISKRVEAEPAEAVEKHEKKVVLKPKIPAKIEEPP
PAKVPGVPKKPVPEKKVPAAVPKVEKVPPVPEEPKKPVPEKRVPPKVAKKEEPPPTKVTE
RHMQITQEEEVHVAVTKKEEPPRARVPEEPKRAVPEEKIPKLKPRREEEPPAKVTELRKR
AVKEEKISIEVPKREAPPVKEVTVTAEKAWSYTREEEIVSVEREEEYDEYEEYDYKELEY
EPTEEYDQYEEYEEREFEHYEEYKEHEEYVTEPRKPLPVKPVQEEPVPTKPKAPPAKVLK
KPVPEEKVPVPIPKKLKPPPPKVPEESKKVVEEKIHISITKREKEQIAEPAVKEPIKPKR
VVTEEKVLVPKKEVTAPVRVAEVLKRQEQEEIVFEEEVVTHVEKYLKEEEEEYIHEEEEL
VTEEEVVPVIPVKVPEIPKKPVPEEKKPVPVPKKKEAPPAKVPEVPKKPEEKVPVPIPKK
EKPPPAKVPEVPKKPVPEEKVPVPVPKKVEAPPAKVPEVPKKPVPEKKVPVPVPKKAEAP
PAKVPEVPKKIIPEEKPTPVPKKVEAPPPKVPKKREPVPVPVALPREEEVPFEEEIAPEE
EVLPEEEEVLPEEEEVLPEEEEVLPEEEEVPPEEEEVPPEEEVPPEEEEFIPEEEVEPEE
EEVLPEIKPKVPVPARVPEVKKKVPEKKVVIPKKEEAPPAPVPEVPKKVEERRIILPEEE
EVPPVEVYEEPEEPIPEEEIPEEPPSIEEVEEVAPPRVPEVVKKAVPEAPTPVPKKVEAP
PAKVPKKVPEEKVPVPVQKKEPPPAKVPEKKVPEKKIAEKKVPVPKKEAVPPAKGRTVLE
EKISVAFHKEEVVRERTELEVVETPVEVLEEEEFHEVQEYFEEEEFHEVEEFIKVERPRV
EDVHRAEEVHRVIEVLETEEVEVYEKPKAPPKGPEISEKIIPPKKPPTKVVPRKEPPAKV
PEVPKKIVVEEKVRVPEEPKFPPAKVPEVPQEIVPEKKAPMVPPKKPEVAPVTVPEAPKE
VVPEKKVSVAPPKKPEVPPVKVPEAPKEVVPEKKVPVAPPKKPEVPPVKVPEPPKEVVPE
KKVSVAPPKKPEVPPAKVPEAPKEVVPEKKVPVMPPKKPEVPPAKVPEVPEAAVPEKKVP
EAVPPKPESPPPAVYEEPEEAAWEEPTAEVVEEPEPAAPPEVTMPPKKPVPEKKPPAVIA
KKPEPPPVKVPEVPKEVTPEKKVPPVVPKKPEVPPAKVPEVPKEVVPEKKVTVPKKPEVP
PPKVPEVPKKPAVEEEPAIPAPEEGEPPAEVYEEPEEVAPEEEEPVPVAEEEPEAPPPAV
PEEPKKIVPEKKVPVIKKPEAPPPKEPEPEKKVIEKPKLKPKPAAPPPAPPKEDVKEKIF
QLKAVPKKKVPEKPEVPEKVELKPLKAPGVEKKVRKLLPEPKPQPKEEVVLKSVLRKRPE
EEEPKVEPKKLEKIKKPVPEPPPKAVEEAEVPPAAVTKRERKVPEPVKVPEIKPAIPLPA
PEPKPKPEPEVKIIKPPPVEPPPTPIAAPVTVPVVGKKAEAKAPKEEAAKPKGPIKGVAK
KTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEMKDIVLTEAESVGSSAIF
ECLVSPSTAITSWMKDGSNIRESPKHRFIADGKDRKLHIMDVQLSDAGEYTCVLRLGNKE
KTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGKI
VPGVIGLLRALTINDADDQDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVK
PKGTAVFSCVIAKETPNIKWFKGYDEIPLEPNDKTEIIREGKQLFLKVKNATPEDIDEYA
VEIEGKRYPAKLTLGDREVELLKPIEDVTIYENESASFDAEISEADIPGQWKLKGELLRP
SPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAFTTAILTVKEIELDFVVPLKDVTVP
ERRQARFECVLTREANVIWSKGPDIIKASDKFDIIVDGKKHILVINDSQFSDEGVYTAEV
AGKKSSARLFVTGIRLKFISPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRT
VLISSEGKTHKLEMREVTLDDISQIKAQVKDLSSTANLKVLEADPYFTVKLHDKTGVEKD
EIILKCEVSKDVPVKWFKDGEEIVPSTKYSIKSDGLRRVLKIKKADLKDKGEYMCDCGTD
QTKANLNIEARLIKVEKPLYGVELFVGETARFEIELSEPDVHGQWKLKGEPLTASPDCEI
IEDGKKHILVLYNCQLPMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAK
FECEVSREPKTFRWLKGTQEITGDDKVELIKDGTKHSLVIKSAAFEDEGKYMFEAEDKHT
SAKLIIEGIRLKFLTPLKDVTAKERESAVFTVHLSHDNIRVKWFKNDQRLHTSRSVWMDD
EGKTHSITFRDLTIDDTSQIKVEAMGLSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQ
CEISKADAPVKWFKDGKEIEPSTNVVIKADGKKRVLLLRKALKSDIGQYTCDCGTDKTSG
KLNIEDREIKLVRPLHSVEVIETETARFETEISEEDIHASWKLKGEALLQTPDCEIKEEG
KMHFLILHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCE
LSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLRAKDFKTHANL
FVKEPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRV
RKLIIHGCTPEDIKMYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVKEKEMARFECELS
RANAKVQWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTV
LEEEAVFTKNLGNVEVSETDTIKLVCEVSKPGAEVVWYKGDEEIIETERYEILTDGRKRI
LTIQNAHLEDAGSYNCRLPSSRTDGKVKVHELAAEFISKPQNLEVLEGEKAEFVCTISKE
SFEVQWKRDDKTLESGDKYDIIADGKKRILVVKDATLQDMGTYVVMVGAARAAAHLTVIE
KLRIIVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRI
RNAQLDDQANYSVSLTNHRGENVKSAANLIVEEEDLRIIEPLKDIETMEKKTVTFWCKVN
RLNVTLKWTRNGEEVPLDNRVLYRIDKYKHSLIIKDCGFPDEGEYMVTAGQDKSVADLLI
IEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSTHR
LIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGTDVVFWAELNKD
KVEVQWLRNNMVIVQGDKHQMMSEGKIHRLQICNIQPRDQGEYRFIAKDKEARAKLELAA
APKIKTEDQDLVVDVGQPLTMVVPYDAYPKAEAEWFKENEPLSSKTVETTAEQTSFRILE
AKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLGWEEPLTDGG
SKIIGYVVERRDIKRKTWVLATDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVET
DNPVEARSKYDVPGPPLNVAITDINRFGVSLTWEPPEYDGGAVITNYVIELRDKTSIRWD
TAMTVRAEDLSATVTDVVEGQDYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNL
TSSDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGKDNWIRCNKKLVPKLTYQVTGLQK
GNKYLYRVSAENEAGVSDPSEILGPLTADDASVEPTMDLSAFKDGLEVIVPNPITILVPS
TGYPRPSATWSFGDKVLEAGDRVKIKTLSAYAELVISPSERPDKGIYTLKLENRVKAISG
EIDVNVIARPSAPKELKFGDITRDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVI
DSVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSVPATVPDPPENVKWRD
RTANSIFLTWDPPKHDGGSRVTGYIVEKCPRGSDRWVACGEPVAETKMEVTGLEEGKWYA
YRVKALNRQGPSKPSKPTDEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKP
EPKITWTKADMLLKQDKRITIENVPKKSTVTIMDSKRSDTGTYIIEAVNVCGRATAVVEV
NVLDKPGPPAAFDITEVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVK
DTNYKATKLTPNKEYIFRVAAENMYGVGEPVQASPITAKFQFDPPGPPTRLEPSDITKDA
VTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVL
AENLAGPGKPSRTTEPILIKDPIDPPWPPGKPTVKDVGKTSLMLNWTKPEHDGGAKIESY
VIEMLKTGTDDWVRVAEGVPTTQHLLTGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCR
EKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVK
DTKCTVTPLTEGSLYVFRVAAENAIGQSDYCEIEDSVLAKDTFTTPGPPYALAVVDVTKR
HVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQV
RAENEAGVGHPSEPTEILAIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIG
YHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAVGVSEPSEISENV
VAKDPDCKPTIDMETHDIVVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKND
HISAHLEVPKCVHADAGVYTITLENKLGSATGKINVKVIGLPGPCKDIKASDVTKSSCKL
TWEPPEYDGGSPILHYVLERREAGRRTYIPVMSGENKLTWTVKDLIPNGEYFFRVKAVNK
IGGGEYIELKNPVIAQDPKQPPDPPIDVEVHNPTAKAMTITWKPPLYDGGSKIMGYIIEK
IAKGEDKWKRCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPI
DAPKVIMRTSLEVKRGDEIALDATISGSPYPTITWLKDEKVITPEEIKKRVAPTIRRKRG
EVQEEEEPFVLQLTERLSIDNSKKGESQLRVRDSLRPDHGLYMIKAENDHGIAKAPCTVC
VLDTPGPPINFVFEDIRKNSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWITVTSTL
RHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLIAKDPFEPPDAPDKPIVEDVTSN
SMLVKWNEPKDNGSPILGYWLEKREVNSTHWTRVNRSLLNSLKTNVEGLLEGLTYVFRVC
AENAAGPGKFSPPSDPKTARDPISPPGPPVPRVTDTSSTTIDLEWEPPAFNGGGEIVGYF
VDKQLVGTNEWSRCTEKMIKPRQYTVREIREGADYKLRVSAVNAAGEGPPGETGPVTVAE
PQEPPTVELDVSVKAGIQIMAGKTLRIPAVVTGRPVPTRVWTIEEGELDKDRVVIENVGN
KSDLIIKSALRKDHGRYVITATNSCGSKSAAARVEVFDVPGPVLDLKPVVTNRKMCLLNW
SDPADDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLIEGQEYMFRVIAKNKFGC
GPPVEVGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHD
KPNFERVNKQLCPTTSLLVEDLDEHQMYEFRVKAVNAVGESEPSLPLNVVIQDDEVPPTI
KLRLSVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNETVIEKPTDALKITKEEVSRSE
AKTELIIPKAVREDKGTYTITASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLT
WDAPLDNGGSEITHYVIDKRDASRKKSEWEEVTNSAVERKYGVWKLIPNGQYEFRVRAVN
KYGISDDCKSDKVVIQDPFRLPGPPGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEK
REEGSAYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGVGPPSEPSDPAI
AGDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEEGSTDWKKVNEP
DKLLTTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEVPEVFIDIGAQ
DCLVCQAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAVKEGVHDVPEDAQVETAENSSVII
IPECTRAHSGKYSITAKNKAGQKTAHCRVKVMDVPGPPKDLKVSDITRGSCRLTWKMPDD
DGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFVVPDLISEQQYFFRVRAENRFGVGPPA
ETVQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTG
KKKEAWKQCNKRDVEELEFTVEDLIEGGQYEFRVKAVNAAGVSKPSATVGPVTVKDQTCP
PSIELKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPRKPDKKEPVVYDTHVNKLVVDD
TCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLS
WLPPLDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKF
GVGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKD
TTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTARD
PIAPPGPPIPKVTDWTKSSVDLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEQGKDKEVRG
TKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRIVPPDLQLDASVRDRIVVH
AGGVIRIIAYVSGKPPPTVTWNMNERALPQEATIETTAISSSMVIKNCQRSHQGVYSLLA
KNAGGERKKTIIVDVLDVPGPVGTPFQAHNLTNDSCKLTWFSPEDDGGSPVTNYVIEKRE
SDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSVGIGPFTETPTALVIRDPITVP
ERPEDLEVKEVTKDSVTLTWNPPKYDGGSEIINYVVESRLIGTEKFHKVTKDNLLSRKYT
VKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDDLAPPTLDLDFRDKLTVRVGEAFA
LTGRYSGKPKPKITWFKDEADVLEDDRTHIKTTPTTLALEKIKAKRSDSGKYCVVVENST
GSRKGFCQVNVVDRPGPPVGPVIFDEVTKDYMVISWKPPLDDGGSEITNYIIEKKEVGKD
IWMPVTSASAKTTCKVPKLLEGKDYIFRIYAENLYGISDPLVSDSMKAKDRFRVPDAPEQ
PVVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRWARVTKEPIHPYTKFRVPDLL
EGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPINPEAIDTTCNSVDLTWQPPR
HDGGSKILGYIVEYQKVGDEEWKRANHTPESCPETKYKVTGLRDGQTYKFRVRAVNEAGE
SDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAVIKGVPFPKVTWRKGDR
EAPTKARIDVTPVGSKLEIPNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLE
VSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHMAKHLNEGN
QYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKNLHHVDVDKTEVSLVWNKPDRDG
GSPITGYLVEYQEEGTEDWIKFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLSLPDTTI
PIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPIPTAKWTTDGSEIKTDEHY
TVETDSFSSVLTIKNCLRKDTGEYQITVSNAAGTKTVAVHLTVLDVPGPPTGPINILDVT
PEYMTISWQPPKDDGGSPVINYIVEKQDTRKGTWGVVSSGSSKTKLKIPHLQKGCEYIFR
VRAENKMGVGPPLDSVPTVAKHKFSPPSPPGKPVVTDVTENAATVSWTLPKSDGGSPIIG
YYVERREVTGKWVRVNKTPIPDLKFRVTGLYEGNTYEFRVFAENLAGLSNPSPSSDPIKA
SRPIKPPGPPINPKLKDKTKETADLVWTKPLSDGGSPILGYVVECQKPGTTQWNRINKDE
LIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDV
ITVRVGQTIRILARVRGRPDPDITWSKEGKVLVREKRVDIIQDLPRVELQIKEAVRADHG
KYIISAKNTSGHAQGSAIVNVLDRPGPCQNLRVSNVTKENCTISWENPLDNGGSEITNFI
VEYRKPNQKGWSIVASDATKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINP
IDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDEWERVHKGSIKE
TQYMVDRCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGD
TIRLEAGVRGKPFPEVLWTKDKDATDLTRSPRVKIDTSADSSKFSLSKAKRSDGGKYVIT
ATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTIRWDPPEDDGGCEIQNYILEKCE
SKRMVWSTYSANVLTPGATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDRPG
RPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSVRWVPVNKSAIPERRLKV
QNLLPGHEYQFRVKAENEIGVGEPSLPSRPVVAKDPIEPPGPPTNLKVVDTTKSSITLGW
GKPVYDGGAPIIGYIVEMRPKREDTSPDEGWKRCNAAAQLVRMEFTVTSLDENQEYEFRV
CAQNQAGIGRPAELKDAIKPKEILEPPEIDLDASMRKLVTVRAGCPIRLFAIVRGRPAPK
VTWRRVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLD
TPGPVTDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREAERKTWSTVTPEVKKTSF
QVTNLVPGNEYFFRVTAVNEYGPGVPADVPKPVLASDPLSEPDPPRKLEVTEMTKNSATL
AWLPPLRDGGAKIDGYIISYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARN
AVGVSLPREAEGVYEAKEQLLPPKILMPEQITIRAGKKLRVEAHVYGKPHPVCKWKKGED
DVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVIVMDAPGPPQP
PFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLI
PGQEYIFRVRAENRFGISEPLTSPKMLAKFPFGVPSEPKNARVTKVNKDCIFVAWDRPDS
DGGSPITGYLIERKERNSLLWVKANDTPVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPP
SKPTEYVTARMPVDPPGKPEVIDVSKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWV
RCNTSPHQIPQEEYTVTGLEENAQYQFRAIAKTAVNISLPSEPSDPVTIQAENVPPRIEL
SVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKEGTLLKPAEGIKMAMKRNLCTLELFS
VNRKDSGDYTITAENASGSKSATIKLKVLDKPGPPASVKINKMYADRAMLSWEPPLEDGG
SEITNYIVDKRETSRPNWAQVSATVPITSCTVEKLIEGHEYQFRICAENKYGVGDPIFTE
PAIAKNPFDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLVEKRETQAVNWTKV
NRKPVIERTIKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPLYPPGPPAFPKV
YDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPEKLQKTRFEVTGLMED
TEYQFRVYAVNKIGYSDPSDVPDKHRPKDILIPPEGELDADLRKTLILRAGVTMRLYVPV
KGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEY
TIVVKVLDTPGPPVNVTVKEISKDSAYITWDPPIIDGGSPIINYVVEKRDAERKSWSTVT
TECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETPGPVVDLKVLSVTK
SSCSIGWKKPRSDGGSRVTGYVVDFLTEDNKWQRVMKSLSLQYSAKDLTEGKEYTFRVSA
ENENGEGTPSEITAVAKDDIVAPDLDLKDIPDLCYLAKENSNFRLKIPIKGKPAPSVTWK
KGEDPLPTDTRVSVESTAVNTTLVVHDCQKSDAGKYTITLKNVAGTKEGTLSIKVVGKPG
IPTGPIKFEEVTAEAMTLKWGPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRV
TRLHEGMEYTFRVSAENKYGVGEGLKSEPVVAKHPFDVPDAPPPPNIVDVRHDSVSLTWT
DPRRTGGSPITGYHIEFKERNSLLWKRANKTPIRMKDFKVTGLTEGLEYEFRVMAINLAG
VGKPSLPSEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHKLTGYIVEMRDLPS
KTWMKANHVNVPDCAFTVTDLVEGGKYEFRVRAKNTAGAISAPSESTGTIICKDEYEAPT
IVLDPTIKDGLTIKAGDNIVLSAISILGKPLPKSSWSRAGKDIRPSDIVQISSTPTSSML
TVKYATRKDAGEYTITATNPFGTKEEHVKVTVLDVPGPPGPIEISNVSAEKATLTWTPPL
EDGGSPIKSYVLEKRETSRLLWTVVAEDIQTCRHVATKLIQGNEYLFRVSAVNQYGKGEP
VQSEPVKMVDRFGPPGPPGKPEVSNVTKNTATVSWKRPVDDGGSEITGYHIERREKKSLR
WVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENKAGIGPPSDASNPVLMKDVAYPPGPPS
NARVTDTTKKSASLAWGKPHYDGGLEITGYIVEHQKVGEEAWIKDTTGTGVRITQFVVPD
LQTKEKYNFRIRAINDAGIGEPAIITDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIF
VPIKGRPAPEVTWTKDDINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKS
GFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATRKSYSTV
TTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPAETTEPVKASEAPSPPDSLNIMDIT
RSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHVSTVKGLECVVKNLTEGEEYTFQV
MAVNSAGRSAPRESRPVIVKEQTTLPELDLRGIYQKLVIARAGENIKVEIPVLGRPKPTV
TWKKGDQILKQTQRVNFENTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHD
IPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTT
YKATRLTTGVEYQFRVKAQNRYGVGPGITSASIVANYPFKVPGPPGTPQVTAVTKDSMTI
SWHEPLTDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAEN
MAGKSKPSKPSEPMLALDPIDPPGKPIPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRD
LPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVE
APRIMVDVKFKDTVILKAGEAFKLEADVSGRPPPTMEWTKDGKELEGTAKLEIRIADFST
YLINKDSSRRDSGAYILTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSEVTSEKCVLSWL
PPLDDGGAKIDYYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGV
GEPLESEPVLAVNPYGPPDPPKNPEVTAITKDSMVVCWGHPDSDGGSEIINYIVERRDKA
GQRWVKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSSTSPFYKACDAVFKPG
PPGNPRVLDSSRSSISIAWNKPIYDGGSEITGYIVEIALPEEDEWKIVTPPAGLKATSYT
ITNLVENQEYKIRIYAMNSEGMGEPALVPGTPKAEERMLPPEIELDADLRKVVTIRACCT
LRLFVPIKGRPAPEVKWTREHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTIENSS
GSKSAFVNVRVLDTPGPPQDLKVKEVTKSSVTLTWEPPLLDGGSKIKNYIVEKRESTRKA
YSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITL
VDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWATCATVKVTEATITGLIQGEEY
SFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTP
AVTWHKDDVPLKQTTRVNAESTENNSLLTIKEACREDVGHYTVKLTNSAGEATETLNIIV
LDKPGPPTGPVKMEEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVAR
TTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPIIAQYPFKVPGPPGTPFVMLSSKDSM
EVHWNEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLDEGIEYEFRVSA
ENIVGIGKPSKVSECYMARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEK
KELPEGRWMKASFTNVIDTQFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDE
VEPPRISMDPKYKDTIVVHAGESFKIDADVHGKPIPTIQWVKGDQELSNTARLEIKSTDF
ATSLSVKEAIRNDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVLVSGVTAEKCTLA
WKPPLQDGGSDIINYIVERRETSRLVWTLVDANVQTLSCKVTKLLEGNEYIFRIMAVNKY
GVGEPLESEPVIAKNPFVVPDAPKAPEITTVTKDSMIVVWERPESDGGSEILGYVLEKRD
KEGVRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSLPSGYQKACDPIYK
PGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTN
IEVEKLLEKHEYNFRICAVNKAGVGEHADVPGPVIVEEKLEAPDIELDLELRKIINIRAG
GSLRLFVPIKGRPTPEVKWGKMDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLEN
SSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATR
KSYAAVVTNCHKNSWKIEQLQEGCSYYFRVTAENEYGIGLPAHTADPIKVAEVPQPPGKI
TVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLEAVITNLTQGE
EYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVRPAFNNYSVQVGQDLKIEVPISGRP
KPTVTWTKDGLPLKQTTRVNVTDSLDLTVLSIKETHKDDGGHYGITVTNVVGQKTASIEI
ITLDKPDPPKGPVKFDEVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDTVSATV
ARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFVTAISKD
SMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAVNLEEGIEYEFRV
YAENIVGVGKASKNSECYVARDPCDPPGTPEAIMVKRNEITLQWTKPAYDGGSVITGYIV
EKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGTISKPSDSTGPITAR
DEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNT
DFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCT
LTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVN
KYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEK
RDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPV
FKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRA
TRFEIAKLTEHQEYKIRVSALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVR
AGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKL
ENSSGSKSAFVTVKVLDTPGPPQNLAVKEVKKDSVLLVWEPPIIDGGSKVKNYVIDKRES
TRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETADAVKAAEPPSPPG
KVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSVVAESKVCNAVVTGLSS
GQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSFKLPFNTYTVQAGEDLKIEIPVIG
RPRPNISWVKDGEPLKQTTRVNVDETATSTILHIKESNKDDFGKYTITATNSAGTATENL
TIIVLEKPGPPIGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSA
TVARTTIKVTKLKTGTEYQFRIFAENRYGKSAPLDSKPVIVQYPFKEPGPPGTPFVTSIS
KDQMIVQWHEPVHDGGSKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEF
KVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGY
IVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNLSEPSESTGAIT
ARDEIDAPNASLDPKYKDVIVVRAGETFVLEADIRGKPIPDIVWSKDGKELEETTARMEI
KSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVSGVTAE
KCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVM
AVNKYGIGEPLESEPVIACNPYKPPGPPSPPEASAITKDSMVVTWARPVDDGGAEIEGYI
LEKRDKEGIRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRAC
DTLYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYMVEVKEGAADEWTTCTPPTG
LQGKQFTVTKLKENTEYNFRICAINSEGVGEPATIPGSVVAKERLEPPEIELDADLRKVV
ILRASATLRLFVTIKGRPEPEVKWEKAEGTLTERAQIEVTSSYTMLVIDNVTRFDSGRYN
LTLENNSGSKTAFVNVRVLDSPSAPVNLNVREIKKDSVTLSWEPPLIDGGAKITNYIVEK
RETTRKAYATVTNNCTKNTFKIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKASEPPL
PPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISG
LTAGEEYTFRVAAVNEKGRSDPRQLGVPVVARDIEIKPSVELPFNTFNVKARDQLKIDVP
FKGRPQATVSWKKDGQILKETTRVNVSSSKTVTSLSIKEASREDVGTYELCVSNSAGSIT
VPITVIVLDKPGPPGPVLIDEVSCDNVTISWSPPEYDGGCQISNYIVEKRETTSTTWHVV
SQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESKPVVAEYPFSPPGPPGTPKVVH
ATKSTMIVSWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEGLMY
EYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKIT
GYIIERRELPDGRWLKCNFTNVQETYFEVTELTEDQRYEFRVFAKNAADSVSEPSESTGP
ITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGVEIEERARTE
IVSTDYNTSLTVKDCIRRDTGQYVLTLKNVAGTRSMAVNCKVLDKPGPPAGPLEINGLTA
EKCSLFWGPPQENGGADIDYYIVEKRETSHLAWTICEGELRTTSCKVTKLLKGNEYIFRV
TGVNKYGVGEPLESMAVKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEISGY
IIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRA
EDPVFLPSPPSKPKIVDSGKTNITISWVKPLFDGGAPVTGYTVEYKKSDETEWETAIQNL
RGTEYTTGGLTTGAEYVFRVRSINKVGASDPSDSSDPQVAKEREEEPVFDLDSEMKKTLI
VKAGASFTMTVPFRGRPAPSVLWSKPDSDLRTRAYIDSTDSRTSLTIENANRNDSGKYTV
TIQNTVNAASLTLVVKVLDSPGPPTNITVHDITKESAVLSWDVPENDGGAPVKNYHIEKR
EASKKAWVSVTNNCNRLSYKITNLQEGAIYYFRVSGENEFGVGVPAETKEGVKITEKPSP
PEKLGVTGVSRDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVRCAVVKSTHHIVSGL
RENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVD
IPISGKPLPKVTLSRDGVPLKATMRFNTEVTAENLTINLKESVTTDAGRYEITAANSSGT
TKAFINIIVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYIVLKRETSTAVW
TEVSTTVARTTIKIMKLTTGEEYQFRIKAENRFGISDHIDSACVVVKLPYTTPGPPSTPW
VTNVTRESITVGWHEPVSNGGSPVIGYHLEMKDRNSVLWQKANKLVIRTTHFKVTTISAG
LIYEFRVYAENAAGIGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGS
KITGYIVERRDLPDGRWTKASFTNVIETQFIVSGLTQNSQYEFRVFARNAVGSVSNPSEV
VGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTNA
LVCVENTTDLASILIKDASRLNSGSYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKT
VTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSIVSENLEECIITTTKIIKGNEYI
FRVRAVNKYGIGDPLESDPVVAKNAFVTPGPPGVPEVTKITKNSMTVVWSRPVVDGGSEV
SGYFLEKRDKKSLGWFKVSKKTIRDTREKVTGLTENSDYQYRVCAVNAAGQGPFSEPSDF
YKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVAMRQGEEEEWTVVS
TKGEVRTTEYVVSNLTPGINYYFRVSAVNCAGQGEPIEMTEAVQAKDILEEPEIDLDVAL
RTSVIAKAGEDVQVLIPFKGRPPPTVIWRKDEKNLSSDARYNIQNTDSSSLLTIPQVTRN
DTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHVSQGTVTLFWDPPLIDGGSPI
INYVIEKRDATKRTWSSVSHKCTSTSFKITDLSEKTPFFFRVLAENEIGIGEPCETTEPV
KAAEVPAPIRDLSVKDSTKTSVTLSWTKPDFDGGSVITEYVVERKGKGEQTWSRAGVSKT
CEIEVSQLKEQSVLEFRVFAKNDKGLSDAVTIGPITVKELVITPEVDLSDIPGAQVAVRI
GHNVHLELPYKGKPKPSISWLKDGLPLKETEYVRFSKTENKITLSIKNVKKENGGKYTLI
LDNAVCRNSYPITIITLGPPSKPKGPIRFDEIKADSVIMSWDAPEDDGGGEITCYSIEKR
EASQANWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSNIIVAKHQFRIP
GPPGKPVVYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNTSPISGREYR
ATGLMEGLDYQFRVYAENSAGLSAPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNP
PLRDGGSKIVAYSIEKRQGSDRWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTI
SPPSQSSGVIMTRDENVPPTVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFRDGV
EIEKKMNMEITDVLGSTSLFVRDATRDHRGVYSVEAKNASGSAKAEITVKVQDTPGKVVG
PIRFTNITGEKMTLWWDAPLNDGCAPVTHYIVEKRETSRLAWALIEDNCQAHSYTATKLI
NGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGTPEPSNVTGNSITLTWARPES
DGGNEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLIEGNEYEFHVMAENAAGIGP
ASGISRLIKCREPVSPPSAPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADL
GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGESSEVTGAIKAVDRLAAPEL
DIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWTKPDSNLSIRADIHTTDSFSTLTVEN
CNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSVTLMWDAPILDGG
ARIHHYVVEKREASRRSWQAISEKCTRQILKVSDLAEGVPYYFRVSAENEYGVGEPYEMP
EPIVATEQPAPPKRLDIIDTSNSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGR
TKQMTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLI
TCKAGSTFTIDVPITGRPAPKVTWKLEEMRLKDTDRVSIITTKDRTTLSVKDSMRGDSGR
YFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWAEPKDDGGTDITNYI
VEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIAEHP
FVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLE
CNYKVSGLVEGLEYQFRTYALNAAGVSKASEASRPMMAQNPVDPPGRPEVTDVTRSTVSL
IWSAPVYDGGSKVVGYIVERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVL
AKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEP
KIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKV
LDSPGPCGNLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTL
SHVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSQPGIPEEVGAGKEHII
IQWTKPESDGGNEINNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTGLMEGCDYQFRVTA
VNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKFSISLAWTKPMYDGGIDILGYV
LEMQEKDTDHWYRVHTNATIRNNEFTVPDLKMGQKYSFRVAAVNAKGMSEYSESTAEIEP
VERLEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKKGIDLANRAIIDTTD
SYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVRVKEVSRDSVTIT
WEVPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIY
GIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAG
TERWMKVVTLKPTVLEHTVISLNEGEQYLFRVRAQNEKGVSEPREIITAVTVQDLRVLPT
IDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLT
IRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPE
LDGGAPLSGYVVEQRDAHRPGWLPVSESVTRQTFKFTRLTEGNEYVFRVAATNRFGIGSY
LQSEVIECRSSISIPGPPETLQIFDVSRDGMTLTWYPPENDGGSQVTGYIIERKEVRADR
WVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINVRGTGKPSRPSKPIVAMDPIAPPGKPQ
NPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREYTLTHL
PQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLT
IPIKGKPFPICKWTKEGQDVSKRAMIATSETHTELVIKEADRDDSGTYDLVLENKCGKKA
VYIKVRVIGNPNPPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREVSKAAWYT
IDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNPPEPPSNPPE
VLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPD
AEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECD
GGKEILGYWVEYRQSGDSAWKKSNKERIKDRQFTIGGLLEATEYEFRVFAENETGLSRPR
RTAMSIKTKLTSGEAPGVRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELVQSR
KYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEK
YYGAVGSTLRLHVMYIGRPVPSITWFYGQKLLQNSENITIENTEHYTHLVMKNVQRKTHA
GKYKVQLSNVLGTVDAILDVDIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITN
YVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISEPLEVASVVI
IKSPFEKPGAPGKPTITALTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWIAVTTE
EIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPATPKSDVPIQAPHFKEELRNL
NVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDA
TVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDP
VITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELD
VADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQARET
RYTVVNLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETREVSMT
KASHSSTKELYEKYMIAEDLGRGQFGIVHRCVETSSKKTYMAKFVKVKGTDQVLVKKEIS
ILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVRQVCE
ALEFLHSHNIGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPE
VHQHDVVSTATDMWSLGTLVYVLLSGTNPFMAETNQQMIENIMNAEYTFDEEAFKEISLE
AMDFVDRLLVKEKKSRMTASEALRHPWLKQKIERVSTKVIRTLKHRRYYHTLIKKDLNMV
VSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGYAKYVCKIENYDQS
TQVTWYFGVRQLENSEKYEITYEDGVATMYIKDITKFDDGTYRCKVVNDYGEDSSYAELF
VKGVRETYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHP
EPRVTWYKSGQKIKPGDDDAKYTFESDKGLYQLTISSVTIDDDAEYTVVARNKYGEDSCR
AKLTVTPHPPPTDTTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPKLKWEKDGQPLSL
GPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYVKQEFKT
KEERERHVQKQIDKTLRMAEILSGTETVPLTQVAQEALREAAILYKPAVSTKTVKGEFRL
ETEEKKEERKLRMPYEVPEPRKYKQTTIEEDQRIKQFVPMSDMKWYKKIRDQFEMPGKID
RVVQKRPKRIRLSRWEQFYVMPLPRITDQYRPKWRIPKLSQDDLEMVRPARRRTPSPDYD
FYYRPRRRSLGDMSDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPSRSPPRFEL
SSLRYSSPQAHVKVEETRKDFRYSTYHIPTRAETSTSYAELRERHARASYRQPKQRQRIM
AEKEEEELLRPVTTTQRLSEYRSELDHMSKEEKSRKKSGRQREVTEITEIEEEYEISKHA
QRESSSSVSRLLRRRRSLSPTYIELMRPVSELIRPRRPPEEEYEDDTERRSPTPERTRPR
SPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERMYEVLSQQPFTLDHAPRIT
LRMRSHRAPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIRYTNMSGVLTLEILDCQ
AEDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASRRRDEQVPPSVFPELTRTEEYAVS
SFKKTSEMEASSSVREMKSQMTETRESLSAYEHHASAEKRSAAVEQKSLEEKSTHRKIKT
TLVGARILTKPRSITVYEGESARFSCDTDGEPVPTVTWLRGRQAISSSARHQVTTTKYKS
TFEISSVQASDEGNYSVVVENSEGRQEAQFTLTVQKARVTEKAVTSPPSVKSPEPRVKSP
EAVKSPKRVKSPEPVTTHPKAVSPTETKPTPTEKVQQLPVSVPPKITQSLKAEASKDIVK
LTCAVESSVLSAKEVTWYKDGKKLKENGHFQFHFSADGTYELKIHNLTESDSGEYICEIS
SEGGTSKTNLHFMGQAFKSIHEQVSRIPETKKAAQKTVESTETKKTEPKAPEPISSKPII
VTGLQDTTVSSDSVAKFAVKATGEPRPTVIWTKDGKAVTQGSKYKLSEDKGAYFLEVHKT
DTSDSGLYTCTVTNSAGSVSSSCKLTIKAVKDTEAQQVSTQKTSEITSQKKAAVQEEISQ
KALISEEMKLAEMKSQEQLALKEEASKVRISEKVKKSEATSLEKSIVHEEITKTSQASEE
IRTHAEIKAFSTQMSITDGQKVTLKANIAGATDVKWVLNGVELANSEEYRYGVSGSDQTL
TIKQASHKDEGILTCIGKTSQGIIKCQYDLMLSKELSDAPAFISQPRSQNINEGQNVVFS
CEISGEPSPEIEWFKNNLPISVSSNISVSRSRNVYSLEIRNASVSDSGKYTVKAKNFRGQ
CSATASLTVLPLVEEPPREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASS
MTEMKFASMSAQSMSSMQESFVEMSSSSFMGKSSMTQLESSTSRMLKAGVRGIPPKIEAL
PSDISIDEGKVLTVACAFTGEPTPEIIWSRGGRKIQNQEQHGRFHIENTDDLTTLIIMDV
QKQDGGLYTLSLGNEFGSDSATVNINIRSM
NT seq 103053 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaagcaccgacgtttcagcagccgttacaaagtgttgtggtactggagggt
agtaccgcaacctttgaggctcacattagtggtttcccagttcctgaggtgagctggttt
agggatggccaggcaatttccacttccactctacccggcgtgcagatctcctttagcgat
ggccgcgctagactgacgatccccgccgtgactaaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgacagcagag
acagcgccacccaactttgttcaacgactgcaaagcatgactgtgagacaaggaagccaa
gtacgactccaagtgagagtgaccggaatccctacacctgtggtgaagttctatcgggat
ggagcggaaatccagagctcccttgattttcaaatttcacaagaaggcgacctctacagc
ttactgattgcggaagcataccccgaagactccgggacctattcagtaaatgccaccaat
agtgttggaagagctacttcgactgccgaattgctggttcaaggcgaagaagtagtaccc
gctaaaaagacaaagacaattgtttcgactgctcagatttcagaaacaagagaaacccga
attgaaaagaagattgaagcccactttgatgccagatcaattgcaacagttgagatggtc
atagatggtgccgctgggcaacagctgccacataaaacacctcccaggatacctcctaag
ccaaagtcaaggtctcccacgccaccgtccattgctgccaaagcacagttggctcgccag
cagtccccgtcgccgataagacactccccttccccggtcagacatgtgcgggcgccaacc
ccatctcctgtcagatccgtgtctccagcgggaaggatctccacgtcccccatcagatcc
gttaagtctccgctactcgcccggaagacccagacacccggcatggccccaggccccgaa
gtgcctcccccttggaagcaggagggctacgtggcctcctctgaggctgagatgagagaa
accacggtgacgagcgccacccagatcaggaccgaggagagatgggaagggagatacggg
atccaggagcaagtgaccgtcagcggaggagcgggcgctgccgccagcgtgtcggccagc
gctgccttcgcggcgggggccgtggctgctggcgctgcagaggcgagacaagaaactgac
aaaagtgcagctgttgcgactgtcgttgctgctgttgatatggccagagtgagagaacca
gtcatcagcgctgtagagcagactgctcagaggacaaccacgactgccatgcacgtccaa
cctgctcaagaacagattaaaaaagaggcagagaagaagacggctgtaactaaggcagta
gtggccgccgataaagaacaagaattaaaatcaagaaccagagaagtaattacaacaaaa
caagagcaggtgcacgtaactcatgaacagataagaaaagaaactgaaaaagcatttgta
ccaaaagtaataatttctgcaactaaagccaaagagcaagaaactagagttactggacaa
attactacaaaacaagaacaaaaacaagtaactcaagaaacaataagacagacagctatg
acagctgctgcgtccatggtggtagctgccaccgcagagaccacaaagctagaaacaatc
ctgggagctcaagaagaaattgccacacaccatgatcaaatgcacataactcaggaaaag
ataacgaaagaaactaggaaaacagtggtacctaaagtcatagttgccacacccaaagtc
aaagaacaagatttagtatcaagaactagagaaggcatcactaccaaaagagaacaagtt
caaataactcaggaaaagatgagaaaggaagctgagaaaactgccttgtctacaatagca
gttgctactgcccaagtagcccaagaacaagaaacaatactgagaactagagaaggaatg
gctactagacaagaacaaatccaagtcactcacggaaaggtggacgttgggaaaaaggcg
gaagctgtagcgacagtcgttgctgcagtagaccaggcccgcatcagagagcccagggag
ccgaggcatcttgaagaatcctatgcgcagcagaccactatggagtatggctataaggag
cacatttccgccacaaaggtagctgagcagccccagcgtccagcctcggaaccccacgtt
gtccctaaagcagtcaagcctagggtgatccaggctccttctgagactcatatcacaact
actgatcaaatgggaatgcacatttcatcacagatcaagaaaactacagatcttacaact
gaaagattagtccatgtggataaacgcccccgcacagcaagccctcactttactgtttca
aaaatttctgtccctaagacagaacatggatatgaggcatcgatagccggtagcgctatc
gccacgttacagaaagagttgtcagccacgtcttctgctcagaagatcaccaagtcggtg
aaggcaccgaccgtgaagcctgctgaggctagagtgagagcagaacccaccccctcaccc
cagttccccttcgccgacacgccagacacctacaagagtcaggctggcattgaagtgaag
aaggaggtaggggtgagcatcgctggtggcacagtccgggaagaacgcttcaaagtccta
cacgagcgtgaaaccaaggtgacagaaacagcaagggtacctgcacctgttgaaatcccg
gttactccaccaaccttggtctcgggcttaaaaaatgtgacggttatagaaggtgaatcc
gtcacgttggagtgccacatctctggatacccctccccaaaagtgacatggtacagggaa
gactaccaaatagaaagttccattgatttccagataaccttccagaatggaattgcccgt
cttatgattcgtgaagcctttgcggaagacagcgggcgatttacctgcagtgccgtaaac
gaggctgggaccgtcagcacatcctgctatctggccgtgcaagcatcagaagagtttgaa
aaggaaacaaccgtgactgagaaattgaccacagaagagaaacgctttgtagagtccaga
gatgtggtgatgacggatactagcatcacagaggaacaagcaggacccggagaacctgcc
gcccctttctttattacaaaaccagtggtccagaaactggtggaaggtgggagcattgtg
tttgaatgtcaggttggcggcaatccaaagccccacgtctactggaaaaaatctggtgtt
cctcttacgacgggatacagatacaaagtgagttacaacaaacaaaccggggagtgcaga
ctggtgatttcgatgacttttgccgatgatgctggagaatacactattgttattcgtaat
aagcatggcgagacttctgcatctgcctccctgcttgaagaagctgagtatgagtcactg
atgaagtcccagcaagaaatgctttaccaaacacaaatgactgcatttgtgcaagaacct
aaagttggagaaatagcacctggatttttatactctgattatgaaaaagagtatgaaaaa
gaacaggccttaattaggaaaaaaatggccaaagatactgtaatggtcagaacttttgta
gaagaacaggaattccatatttcttcctttgaagagaggcttatcaaagaaattgaatac
agaataataaagactacattagaagaacttcttgaagaagatggagaagaaaagatggca
gttgacatttctgaatcggaagctatcgaagcaggatttgacttaagaatcaagaattac
agaattctcgaggggatgggtgttacttttcattgcaagatgtctggatatccattaccc
aagattgcatggtacaaagacggcaaacgcatcaagcatggagagagataccaaatggac
tttctgcaagatggcagagctagtctgcgcatacctgttgttcttccagaagatgagggc
atctatactgcatttgccagcaatatgaaaggaaatgcaatttgctcggggaaattgtat
gtcgagcctgctgcgcctcttgctgctccgacttacatacccaccccagaaccagtgagc
agaatcagatctatctctccacgttcagtgagtagatctcctatacgcatgtcccctgca
aggatgtcccctgcaaggatgtcccctgcacggatgtcccctgcaaggatgtcccctgga
cgtaggctggaggaaacagatgagtcacaacttgagagactctataagccagtctttgtg
ttaaagcctgcttctttcaaatgtttggaagggcaaactgccagatttgacttaaaggtt
gttggtagacctatgccagagaccttctggtttcacgatggccagcaaattgtcaatgat
tatacccataaagtagtcattaaagaagatggtacccaatcactgattattgtccccgca
gcgcccagtgattctggggaatggactgttgttgcccaaaacagggcaggcaaatcttcg
atttcagtgattttaactgtggaagctgtggaacatcaggtaaaaccaatgttcatagaa
aaactaaaaaatgtcaatataaaggaaggttctcgacttgaaatgaaagtcagagctacg
ggtaatcccaaccctgatatcgtatggctgaaaaacagtgacatcattgtacctcataaa
tatcctaaaatcagaattgaaggaaccaagggagaggctgcccttaaaattgactccact
gtcagccaggattctgcctggtatactgcaactgctattaataaggctggccgagacact
acaagatgcaaagtgaatgttgaagttgagtttgcagagcctgaaccagagagaaaatta
atcatcccacgagggacttatagagcaaaggagatcgcagccccagaactggagcccctc
catctgcgatatggtcaggagcaatgggaagagggtgacctctatgataaagagaaacaa
cagaaaccgtttttcaagaaaaaactcacttccttaagactcaagcgctttgggcctgcc
cactttgaatgtaggctaacaccaattggtgacccaacgatggtggtggaatggctccat
gatggaaagccacttgaagcagccaacaggctccgtatgatcaatgagtttgggtattgc
agccttgattatggagttgcatattccagagacagtggtatcattacatgcagagctact
aacaaatacggaacagaccacacatctgccacacttattgttaaagatgaaaaaagtctt
gtggaagaatctcagttgcctgaggggaggaaaggcttacagagaattgaagaattagag
aggatggctcatgaaggtgcacttacaggtgtaacaacagaccagaaagagaagcaaaag
ccagacattgtcttgttcccagaaccagtaagagtacttgaaggggagaccgccagattc
cgttgccgagtgacaggttaccctcaacccaaagtcaactggtacctcaatggacagctg
atccgcaaaagcaaaaggttcagagttcgctatgatggcattcactatttggacattgtg
gactgcaaatcatatgatacaggggaggtcaaggtcactgcagaaaatcccgaaggtgtg
atagagcataaagtgaaacttgaaatccaacagagggaagattttaggtctgttctcagg
cgagcccctgaaccaaagcccgagtttcacatacatgaacctggaaaacttcagtttgaa
gtacaaaaagtagatagacctgttgataccactgaagccaaggaagttgtgaagttgaaa
agagctgaaagaattacccatgaaaaagtatccgaagagtccgaagagctgcgcagtaaa
ttcaagcgcaggactgaggagggatattacgaagccattactgctgtggagctcaagtct
cgtaagaaggatgaatcctatgaggagctcctaaggaagacaaaagatgagcttctccac
tggaccaaagaattaactgaagaggagaagaaagtccttgctgaagaaggcaagatcact
attccaacgtttaaaccagataaaattgaactgagtcctagtatggaggctcctaaaata
tttgaaagaatccaaagccaaacggtgggccaaggatctgatgcacacttccgggtcaga
gtggtgggaagaccagatcctgaatgtgaatggtacaaaaatggtgtaaagatcgaacgc
tctgaccgaatctactggtactggcccgaagacaatgtttgtgaactggtcataagagat
gtgactgccgaggactctgccagcatcatggtgaaagccatcaacatcgctggggaaacc
tcaagccatgcattcttacttgtccaagccaagcaatcaatcattttcacacaggaatta
caagatgttgttgctaaggaaaaagacaccatggcaacctttgaatgtgaaacttcagag
ccatttgtcaaagtgaagtggtacaaagatggtgtggaggttcatacgggagataaatac
aggatgcactctgacagaaaggttcacttcctctccatactgacgattgacacatccgat
gctgaagactacagctgcgtactcgtggaagatgaaaatgtcaaaacaacagcaaaactt
attgtcgaaggtgcagttgttgaatttgtaaaagaacttcaggacatagaagttccagaa
tcattttcaggagagttagagtgcgttatatctccagaaaatatagaaggcaaatggtat
cataatggcgtggagctgaaatccaatggcaaatacacaattacatctcgccgtggacgt
cagaacctcacagttaaggatgtgaccaaagaggaccagggagaatacagctttgttgtt
gacgggaaaaagacaacctgtaaactaaagatgaaaccccgccccatcgctatcctacaa
ggacttagtgatcaaaaagtctgtgaaggtgacattgtccagcttgaagtgaaggtctcc
ttggagaatgtggaaggtgtctggatgaaagatggccaagaagtgcagcccagtgacaga
gttcacattgtgatagacaaacagtcccacatgctgctcattgaagatatgactaaggag
gatgctggaaattactccttcaccattccatccctcggactgtcaaccagtgggcgcgtc
tctgtctacagtgtggatgtgataactcctctaaaggatgttaatgtccttgagggtacc
aaggctgtgcttgaatgtaaggtctcagttcccgatgtgacttctgttaaatggtattta
aacgatgaacaaatcaagcctgatgatcgtgtacaagccattgtcaaaggcactaagcag
cgactagtgattaaccggacccacgcttcagatgaaggaccttacaagctgatggttggc
agggttgaaaccagctgtgatctctctgtggaaaaaattaaaattatcagaggtcttcgt
gaccttacctgtacagaaactcaaaatgtggtcttagaagttgagctgtcccactcagga
attgatgttttgtggaattttaaggaccaggaaatcaaacccagttctaaatataaaatt
gaagctcatggaaaaatatataagttgacagttctaaatatgatgaaagatgatgaagga
gagtacacattttttgccggagaaaatatgacatctggaaaacttactgtggcaggggga
gccatctccaagccactcaccgaccagactgtggctgaatcgcaggaagctgtgtttgaa
tgtgaagttgccaacccagattccgaaggcgaatggctgaaggacggcaaacacctacca
ctgagtaacaacgtcaggagtgaatctgatggccacaaaaggagacttatcatcgctgcc
accaaattagatgacattggagaatacacctacaaggtggccacctccaaaacatctgcc
aaactcaaagttgaagctgtcaaaattaagaagactctgaagaacctcaccgtgacagag
acgcaggatgctgttttcactgttgagcttacgcatcctaacgtaaaaggcgtccagtgg
atcaaaaatggcgttgtgctgcgatccaatgacaagtacgacatctcagtcaaaggaaca
gtttacactctgaggattaaaaactgtgctgttgtagatgaatctgtatatggcttcaag
cttggaaagctaggagccagtgccagactacatgtggagactgtcaagatcattaaaaag
ccaaaagatgtgaccgccttggaaaattccaccgttgcctttgaagttagtgtttcccat
gacactgttccagtaaaatggttccacaagaatgtggagattaagccaagtgacaagcac
aggctggtctcagaaagaaaggtgcacaaactgatgctgcagcacatttccccctcggat
gctggggaatatacagccgtggtggggcagctggagtgcagagctaaacttttcgtggag
acattacatattacaaaaaccatgaaaaacattgaggtacctgagaccaaatctgcctcc
tttgagtgtgaggtgtcccacttcaatgtcccttccatgtggctgaagaatggcgtggag
attgagatgagtgagaagttcaagatagtggtgcaggggaaactccaccagctgatcatc
atgaacaccagcacagaggactcggcagagtacacatttgtctgtggcaatgaccaagtc
agcgccaccctgagagtcaccccaatcatgattacatccatgctgaaggacatcaatgct
gaagaaaaagacaccattacctttgaggtaacagtgaactatgaaggcatctcttacaaa
tggttaaagaatggtgtggaaatcaaatcaactgacaggtgccagatgagaaccaaaaag
ctcacgcactcactgaatatcaggaatgttcactttggggatgcagctgagtacaccttc
gtggctggaaaagctacctcaacagccaccctttacgtggaagctcgccacatagaattt
cggaaacacatcaaggatattaaggttcttgagaagaagcgagccatgtttgagtgtgaa
gtttctgaacctgacatcactgttcagtggatgaaagatggccaagagctgccgactgtg
gacagaataaagatacagaaggagaaatacgtccaccgcctgctgatcccctccacgcgg
atgtctgatgccgggcaatacgcagtggtggcaggaggcaacatatccaccgctaacctc
tacgtagaaggcagagacgtccgcatccgaagtctgaagagggaggttcaggttattgag
aaacaacgtgctgtcgttgagtttgaggtcaacgaagatgatgttgatgcccactggtat
aaagatggcattgaaatcaatttccaaattcaagaacgacatcaatatgtggtggagaga
agaatccaccggatgtttatctctgagaccaggcatagtgatgctggtgaatacaccttt
gtggcaggaaggaacaggagttctgttactctctatgtcaatgctccggagccgccccag
attctgcaggagctccagcccatcactgtgcagtctggcaagcctgcccgcttctgcgcc
gtgatagccggcagaccgcagcccaaaattgcctggtacaaggaagagcagctgctttcc
actggcttcaaatgcaaatttcttcacgatgggcaagagtacacacttctgctcatcgaa
gccttcccagaggacgcagctgtttacacctgtgaagccaagaatgactatggagtcgcc
acaacctccgcttcgctctcagtggaagttccagaggttgtgtctccagatcaggaaatg
ccagtttatcctcctgccgtcatcaccccccttcaggacactgtcacttcggagggacag
ccagcccgttttcagtgcagagtgtctggaacagatctaaaagtgtcttggtacagcaaa
gacaagaaaatcaagccatctaggttctttagaatgactcaatttgaagacacttaccaa
ctggaaattgctgaagcttatccagaagatgaaggactttacacttttgttgctaataat
gctatgggtcaagtatcaagcacagccaacttgagactggcagccccagaatccattttg
cacgggaggattgaagagcagattgaggtggagatgaaagagttttctagttctcttctg
tctgccgaggaagaaggattccaaacctatagctctggccttcagttatctaatagaaat
gaaacacttgaactttcatctgaacttccagttcagtcaactacatttgattccaaaaag
gaaggccgtgttccaattttcatcaaagaagcgtcaaatgctgaaataagcgtaggggat
gtggctaaactgtctgttactgtcactggcattcccaagcctaaaattcagtggttcttt
aatggagtaatgttaaccccttctgctgactacaaatttgtttttgacggcaatgatcat
agtttgatcatcctgttcacccaatttgaggatgagggagagtatacatgcattgccagt
aatgaatatggacagacagtatgcagtgcctatctaaaaattagttccaaaggagaggcg
cacaaagagaaagaaccagaaccagtggaaaaaaatctggaaaagtttgaaggtccttgt
cctccttacttccttaaggagttcaaaccaattcactgtgctcagggtctccctgctgtc
tttgagtacaaggtgcttggagagcctgcacccacggtcttgtggttcaaagaaaacaag
cagctttacaccaatgtttattacaccatcatccataaccctgatggttctggaacattc
attgtcaatgaccctcagagggaagatagtggcctctacgtctgtaaagcagagaatatg
tggggtgagtcgacctgtgctgcggagctgcttgtgcttctggaagacacagacaagcct
gatgctccctgcgaggcagagcccacaccagaggctactaaagattttccgcagatgtca
ctaaagggtcctgcagtcgaagcctttgactcagagcaggaaattgcagcttttgtaaat
gacaccattttgaaagctgcttcaattgcagaagaaaaccagcagctttcttatgagcat
atcattaaaaccagtgaactgagtagtcaagttactttagtggctgagcagttgcaatcc
acagtcatgttggagcagaacgtgcctgatccagaaagcaccagggcacttctttccatc
aatggcaccattcacgttcggcctatcaaggaaccatctcccaatttacagctgcagatt
gtccagtcccagaaaaccctcccgaaagaagatgtcctaatgcttcaagagcctgagtca
caggtggtcctatcagatactgaaaaaatcttcccaagtgccatgtccatagaagaaatt
agttcattaatggtggagcctctgaaaactttcctagctgaacctgaagggagttatcca
cagtcttcaatagaagaagctccagcccattcatatccaacctctgtggctgaggaagtg
ctgtcatcaagagaaaagacagcatctgcaatggacaaagagcaaagactgacccttcca
aagcaagaggcacaaagtgctctcaccctgagtcagagcttagctgagggaagcatggaa
agtcgtaagggtcctgaggtcaagccccaggtcccttcagaacacacatgcacggaagat
gaaattttgatggaaagtgcagatcaactggaaagtgcagggcaggattttgcagccagg
actgaggaaggcaagtccttaaggtttccgctagcatgtgaggaaaagcaggtactgctc
aaggaagagtgttctgaccacttggcagtgcccctgaaccaaaccagtgagtataaaaaa
gagcccatgatgataaatggtgtgcaagaggtgcagacaagtgacactcttcctaaggag
agtttgcttcctggaattccagaagaacaacgattaaacctcaaaactcagatccgcagg
gctttgcaagcagcagtggccagtgagcagccaagtcttttctctgaatggttaaggaac
gttgaaaaggtggaggtgaaggccataaacttcacccaagagcccagacgcattctgtgt
acctaccttattacctcagtgaagactctaacggaagaattcaccattgctattgaaggc
attgatcctcaaacggctaacttgaaaactgaactgaaggatgctctgtgctctattgta
tgtgaggagataaacgtcttaacagctgaggatcccagaatccagaaagggggctttcag
gaagagccgggtccttttttagattcacagaaggttgaagcaatctgggaaccagaagtc
gagtctaaacatcttgtctctgcagaagaggtcagctatgttcatgtggaaagtcaggtc
aaagttgcagataccacacctgtccctgatggcgttgctctggctgctagccctgaggaa
aaacagggtgagactccaaagccgtcagaggcaagagagaagtcctctggaagtggtact
ggggaggtgggcctaggagagctacaggaagctgagggtagcttagccgaagaggacggt
cctgtcatacacacgcccttggtggacacgactgcggaggaaggtgacattgtaaacctc
acgacattcataacaaatgccaaagaggtgaattggtattttgagggcaaactggtgcat
tcagatgaaaagttcaagtgtttacaagatcaaaatacatatacgctagtgatcgacaaa
gtaaatacggaagaacatcaaggagcatatacctgcgaggccttgaacgacaaggggaat
gcagcaacttcggccaaactcactgtagtcaaaagagctgccccagtgatcaaaaggaga
atcgagcccctggaagtagctctgggccacctagccaaattcacctgcgaggtccaaact
gcccccaatgtccggttccagtggtttaaagctggccgagaaatttacgaaagcgacaag
tgttcgattcgatcttcgaagtatgtctccaccctggaaatcctgcgaacccaggttgtg
gactgtggcgagtacacctgcaaagcctccaacgagtacggcagcgtcagctgcacagcc
acgctgaccgtgacagaggcatatccaccaagcttttactccagacctaagtccgttaca
acttttgtgggtaagacagccaagttcctctgcacagtattagggactcccgtgatcgaa
accatttggcagaaagacggggctgcgctgtcaccttcccctaaccgcaagatttcagag
gcagaaaataaacacagtttagaactctcaaatcttacaattcaagatagaggagtttat
tcttgtaaagcttctaacaagtttggagctgacatctgccaagctgagttaatcatcatc
gacaagccacatttcattaaagaattagaacctgtgcagtcagcaatcaataagaagatc
cacctcgagtgccaagtggatgaagacagaaaggtgacagtaacatggaataaagatggg
caaaaactcccccctgggaaagattataagatctattttgaagataaaatagcatcactt
gagatccctctggccaaactcaaagattcaggaacttacgtttgtaccgcttccaatgag
gctgggagcagctcttcttcagcaacagtcaccatcagagaaccaccgtccttcgtgaag
aaggtggacccctcttatttaatgctgccaggtgaatcagcacgcctccattgcaagctg
aaaggctcacctgtgatccaggtcacttggtttaaaaataacaaagaacttagtgagagt
aacactattcgaatgtctttcgtcaattctgaggctgtgcttgatctgacggatgtcaaa
gttgaagatagtggcagttactcatgtgaggcggtgaatgacgttggcagtgactcgtgc
agtgctgaaatcgttatcaaagagcctccttctttcatcaaaacccttgagcctgcagat
atagtgagaggaacaaatgcccttcttcggtgtgaaatctcaggcactggaccctttgaa
attagctggttcaaagacaagaagcaaattcgaagtagtaaaaagtacaggttgttttct
cagaagtctctggtgtctctggagatcttttctttcaatagtgcagacgttggtgaatat
gaatgtgtggttgctaatgaagtcgggaagtgtggctgcagtgcaacacacttactgaaa
gaaccgccaacctttgtaaagaaagtagatgattttaccgcactagcaggtcaaactgtt
accttacaagctgccgtgagagggtcagaacccatctctgtcacctggtttaaaggacaa
gaaataattaaagaagatggaaagatcaaaatgagcttttctaatggtgttgcagtcttg
atcatccctgacgttcagattagttttggtgacaaatacacctgcctggctgaaaacgaa
gccggaagccaaacgtctgttggggaattaatagttaaagaacctgccaaaattgttgag
agagcagagctgatccaggtgacagcaggagacccagccacgctggagtatacagtcaca
ggcaccccagagctcaagcccaaatggtacaaagatggaagacctttggttgctagtaaa
aagtatcgaataagttttaaaaacaatgttgcccaactcaaattttattcagccgaactg
cacgatagcggccagtacacatttgagatttccaatgaagtgggcagcagctcctgcgaa
acaacgttcactgtattggatcgagacatcgctccgttctttaccaaacccctacgcaac
gtgggcagtgttgttaacagcacctgcaggctggactgcagagtcgctggctctcttccc
atgagggtgtcctggttcaaggacggtagagaaatagcttcttctgacaaatacagaata
gcctttgtggaaggcacggcctctttggagataagcagagtagacatgaatgacgcgggc
aatttcacttgtcgagccacgaattccgtgggaagcaaagacagcagcggagccctgatt
gtgcaagaaccacccagttttgtaactaagcctgcatccaaggacgttctgcctggctca
gcagtctgcctgaagagcaccttccaagggtccacccctttcacagtcaaatggtttaag
ggtgccaaagagcttgtctctggtggaagctgctatattagcaaagaagctttagaaagt
tccctggaactctatgcagtaaaaacctccgattctggcacatacacctgccaagtcagc
aacgttgccggaagcgtggagtgcagtgcaaacttatttgtaaaagagcccgccacgttt
gttgagaggttagagccatcacagttgttaaagaagggagatgccacccagctggcctgc
aaagtcactggtacccctccaattaaaatcacatggtttgcaaatgatagagaaatcaag
gagagcagcaagcacaaaatgacttttgtggagtccaccgccgtcctaagacttacagat
gttgccattgaagacagtggcgagtacatgtgcgaggcccaaaatgaagctggcagtgac
cactgtggtagcattttgatagtcaaagagtcaccttactttaccaaagaatttaagccc
attgaagtgttgaaggaatacgacgtcatgttgctggccgaggtggcaggcacacctccc
tttgagatcacttggttcaaagacaacacgacgctgagaagtggtaggaagtataaaacc
ttcattcaggaccagctggtgagcctgcagatcctcaagttcgtcgccacggatgctggt
gaataccagtgccgggtgaccaatgaggtgggcagcagcacctgcactgcccgggtgact
ctgagagaacccccagcctttgtgaagaagatcgagagcaccagctcccttcgggggggc
accgctgccttccaggccactctcaagggctccttgccgatcaccgtgacttggttaaag
gacaatgaggaaatcaccgaggacgataatataagaatgacctttgagaacaatgtggct
agtctgtacctcagtggcatcgaagtcaagcatgatgggaaatatgtctgtcaggccaga
aatgatgcaggaatacatagatgttctgcactgctctcagtgaaagaacctgcaacaatc
accgaggaggctgtgtctatagatgtcacccaaggggacccagccactttgcaggttaaa
ttttcagggactaaagagcttacagccagatggtttaaagatggccaagaactgaccctg
ggccaaaaatacaaaatcagcgtcactgacacagtctctgtactgaagattatttctaca
gaaaagagagatagtggagaatatacttttgaggtccaaaatgatgttgggagaagcagc
tgcaaggctagcattaatgtattagatcttatcatacctccctcattcaccaaaaagctg
aagaaaatggacagcattaaagggtcttttattgacttagaatgtatagtggctgggtca
catcccatcagcatccagtggttcaaagacgaccaggaaataacagctagtgaaaaatac
aaattctcttttcatgacaatactgccttcttggaaatcagtcatctggaaggtacagac
agtgggacatacacctgttcagccaccaataaggcaggacacaaccagtgcagtggccat
ctcacagtcaaagaacccccttacttcatggaaaagccacagtcacaagacgtcagtccc
catacaagggttcagctaaaggctcttgtgggtggcactgcgcccatgaccataaagtgg
tttaaagataacaaagagttgcactcaggagcagctcgctcagtttggaaggatgacacg
tccaccatcctggagctcttttcagccaaagctgccgattctgggacctacatttgccaa
ctaagcaacgatgttggcaccgcaaccagtaaagccactctctttgtgaaagaacctcct
caattcattaagaagcccagccccgtattagtgctgagaaacggacagtcgacaacattt
gaatgccaaataacaggcactcctgaaatcagagtttcttggtatctggacgggaatgaa
ataacagccattaagaaatatggcatttccttcatcgatggtgtagccactttccaaatt
tctggtgccagggtagaaaacagcgggacttacgtctgtgaagcccgcaatgacgcaggc
acggcaagctgcagcattgaattaaaagtgaaagaacctcccacctttatcagggagctg
aggcccgtggaggtcgtgaaagatagtgacgtgcagctggagtgtgaagtggcgggaacg
tctccatttgaggtcacttggctgaggaataacaaggaaattcgaagcagcaaaaaatat
accctaaccgacagagtatccgtgtttaacctccatataacccggtgtgacccctcagac
actggtgaataccagtgcatcgtatccaatgaaggcggcagctgctctagcagtacccgg
gtctccctgaaagaaccaccatcgttcatgaagaagatagagaacctcaccactgttttg
aaaagctctgccacctttcagagtacggtggcgggctctcctcccatttctataacctgg
ctcaaggatgatcacattcttgatgaagatgataatgttcatatttcgtttgtgaacaat
gtggccacgcttcagatcagagctgtggacaacgggcacagcgggagatacacgtgtcaa
gccaagaacgagtcaggcgttgagcggtgttatgctttccttttagtccaagagcctgct
cagatcctagagaaagcgaagtctgtcgatgtcactgagaaagacccggtgactctggag
tgcgtagtggccgggacaccagaactcaaagtgaaatggctgaaggatggaaaacaaatt
gtgcctagtagatatttttcgatgagttttgaaaataatgtggccagttttaggatccag
tcagtcatgaagcaagacagtggtcagtacacattcaaggtggaaaatgactttggaagc
agtagctgcgacgcccacctgagagtgctagatcaagatatccctccatctttcaccaaa
aaattaaccaaaatggataaagttctggggtcttctattcgtatggagtgcaaggtttct
ggctcacttcctattagcgctcagtggtttaaggacggaaaagaaatatctacaagtgca
aaatacagacccatcagtcacgagaacacagtgtcactggaagttaataatctggaatta
gaggatacggcgaattacacatgcaaggtctcaaacgtagcaggggatgatgcatgcagt
ggcatcttaactgttaaagaaccaccaagcttcctggtgaaacccgagcgacaacaagcc
ataccggattctacagtagaatttaaggcagtattgaaaggaacaccaccatttaaaata
aaatggtttaaagatgatgtggaacttgcctctggacctaaatgtttcattggcttggaa
gggtcaactagcttcttaaatctctattcagtggatgcttccaagactggacaatacact
tgccaagttaccaatgacgttggtagcgactcttgtactacggtgctgcttgtgacagaa
ccaccaaagtttgtaaagaaattagaaacatccaaaatagtgaaagcaggtgactccaca
cgacttgaatgcaagataacgggatccccagaaatcagagttgtgtggtacagaaatgaa
cacgaactccacgccagtgataaatacagaatgactttcattgactcagtggccgtccta
cagatgaacaatctcggcactgaggacagtggggatttcatttgtgaggctcagaatcct
gccggcagcacaagctgcagtaccaaggttatcgtaaaagaaccacctgtttttagcagc
ttccctcctgtagtagaaacccttaaaaatactgaagttagtcttgagtgtgaactatcg
ggaacaccaccattcggcgtgatctggtacaaagacaagcggcagctccgaagtagcaag
aaatacaagattgcatccaaaaatttccacgcaagtattcacattctcaatgttgaagct
tcggacattggtgaatactactgcaaagcccagaatgaagtcggaagtgatacttgtatt
tgtactgtaaaattaaaagaaccaccaagatttgtctccaaactgaacagcctcacggtt
gtagctggcgagcccgctgagttacaagcatccatagaaggagcccagcctatttctgtc
cagtggcttaaagagaaagaagaagtgatcagagaaagtgaaaacatcagaattacattt
gtagaaaatgttgcaactctgcagtttgcaaaagcagaaccagctaatgctgggaagtat
atctgtcaaatcaagaatgatggtggaatgagggagaacatggccacactgactgtttta
gagcctgcagtcattgttgagaaagcaggatcaatgacagtggctgtgggagaaacgtgc
actctggagtgtaaggtggccggcactcccgaactctcagtagaatggtacaaagacgga
aagctgttgaccagcagccaaaaacacaaatttagcttctacaacaaaatctcttcctta
aagatactctctgttgaaaggcaagacgcaggcacatacaccttccaggttcaaaataac
gttggaaaaagcagctgcacagctgtggttgacgtttcagaccgaatggtccctccctct
ttcacccgaagactgagaggtactgttggggtgctgggtacttcttgcatcctggagtgc
aaagtagctgggtcatcacctatctctgttgcctggtttcatgaaaaaactaagattgtc
agtggagcaaagtaccaaaccacattctccgataacgtctgcacattgcagctgaattct
ttggactcctcggacacgggcaattacacgtgcgtggccgctaatgccgccggctctgat
gaatgtcgtgcagcgttggctgtacaagaaccaccctctttcgtgaaggaacctgaacct
ttggaaatactaccaggcaaaaatgtcaccttcacaagcgttattcgagggacccctccc
ttcaaggtcggctggttcagaggcgccagagaactcgtgagaggagaccggtgtaacatt
tattttgaagacactgtggcagaactggaattatttaatgttgacatctctcagagtggg
gaatacacttgtgtggtttctaacaatgctggccaaacgtcctgcacgactcatctcttt
gtgaaagaaccggctacctttgtgaagaagttaagtgatcactctgtagagccagggaag
tccataattctggaaggcacctacactgggacacttccgatttcagttgcctggaaaaag
gatggtgttaacgtaactccatctgagagatgcagcatagtcacaacagagaaaacttgc
atcctagaaattctgaacagcacaaaaagagatgcaggacagtactcctgcgaaattgaa
aacgaggcagggagggatgtttgccaagctctggtatctacgttagaaccaccttatttt
gttacggaactagaacccctggaggcatctgttggagattcggtttctttacagtgccaa
gttgctgggacaccagaaattacagtgtcttggtacaaaggagacactaagttacggcca
actccggaatacaggacctattttacaaacaatgtggccacactggtttttaataaagtg
aatattaatgacagtggagagtacacatgtaaagcagaaaatagcataggaactgcttct
tctaagactgtcttcagaattcaagagcgccaactcccaccttcctttgcaagacaactg
aaagacattgaacagactgttgggttgccagttacactcacttgtcgattaaatggctcc
gcacccatccaagtgtgctggtatagagatggggtacttttacgagatgacgaaaatcta
cagacgtcatttgtagataatgtggcaactttaaaaattttgcaaacggacttgagtcac
tccggccagtactcctgctcagcttctaacccacttggaacagcgtcttctagtgctaga
ctgacagcaagagaacctaagaaatctcccttctttgacatcaagcctgtatctattgat
gtcattgctggggaaagtgctgactttgagtgtcatgttactggtgctcaaccaatgcga
atcacttggtcgaaagataacaaggagatacgacctggaggaaattatactatcacatgt
gtgggaaacactccccatctgagaattcttaaagtaggcaaaggagactctggtcaatat
acttgccaagcaaccaatgatgttggcaaagacatgtgctcagctcaactcagtgtaaaa
gaacctcccaagtttgttaagaagctagaagcttctaaagttgtgaagcagggagaatcc
atccaactggaatgcaaaataagtggttccccagaaatcaaagttgtgtggttccgaaat
gacagtgaactccatgaaagttggaaatacaacatgtcattcgttaattctgtggcactg
cttaccatcaatgaaggcagcactgaggatagcggggactatatctgtgaagctcataat
ggtgttggtgacgccagctgcagcacagccctgaccgttaaagcacctcctgttttcacc
cagaagcctgctccaataggagctcttaaaggttctgatgttatcttccaatgtgaaatt
tcgggaacccccccatttgaagtggtgtgggttaaagatcgaaagcaagttcgaagcagc
aagaaatttaaaatcacttcaaaaaattttgatacaagtcttcatatccttaaccttgac
acttccgatgtaggagaatatcattgcaaagctactaatgaggtgggaagcgacacgtgt
gtttgcactgtcaagttcaaagaacccccacggtttgtgaaaaagctaagcgacacctca
acccttgttggggatgctgttgagttacgggctgtagttgaaggcttccagccaatttct
gttgtctggctgaaagataaaggtgatgtcatcagagagagtgaaaacactaggatttca
ttcgtcgataatgtcgcaaccctccagcttgggagccctgaagcatctgattctggaaaa
tatgtgtgccaaatcaaaaatgatgctgggatgagagagtgttcagcagtcttgactgta
gtagaaccagccagaatcgtagagaagccagaacccatgactgtcactactggaaatcct
tttgctttagagtgtgtagtggctggaacaccagaactttcagtcaagtggttcaaagat
gggagagaattatctgcagacagcaaacatcagattacattcatcaacaaagtggcttcc
attaaaatcccttgtgcagaaatgagtgacaaggggttatatagctttgaagtgaaaaac
agtgttggtaaaagtacctgctctgtatccgtccacgtgtcggatcgagttgtgcctcct
tccttcatccgcaagctgaaagacatgaacgccatcctggggacctcggccgttctggag
tgccgagtctctggctcagccccgatttcagttggctggtttcaggacggaaatgagctc
gttagcgggcctaaatgccagtccagcttttcagaaaatgtctgcacgttgaatctgagc
ttattggagccctcggacacaggcgtatacacgtgtgtggctgccaacgtggctggttct
gacgagtgctcggccgtcctgaccgtgcaagaaccaccatctttcgaacaaatccccgac
tctgtggaagttttacctggaacgagcctcatcttcaccagcgtctttagaggcacccct
ccgttcaaggtcaaatggtttaagggcagcagggaactggtgtcaggggagtcatgcacc
atctctctggaagattttgtgacagaactggagttgttggaggtggagccgttgcagagt
ggagactattcttgcctggtgaccaatgacgcgggcagtgcctcttgtactgcccatctt
tttgtgaaagaaccagccacctttgtgaaaaggttggctgatttcaacgtggagactgga
agccccatagtccttgaggccacgtttactggcacacctcccatctcggtgagctggatg
aagaatgagttccttctttcacagtctcagaactgcagtattaccatgacagagaaatcg
acgatcctggaaattacagaaagcactatagaggattatgcccagtacagctgcctgata
gaaaatgaggccggtcaagatatttgtgaagctctggtgtctgtcttagaaccaccctat
ttcattgaacctctgcaacacgtagaggcaaccattggagaacccacgactttacagtgt
aaagtggatggaaccccagaaattagaatttcttggtataaagaacacacaaagctacga
tcggctcctgcatataaaatgcaatttaaaaataacgttgcctctttagtaatcaacaaa
gtggaccacagtgacgtgggagagtacacatgcaaggcagagaacagcgtgggggcagtc
gcttcttccggcgtgcttgttatcaaagagcgtaaacttccaccttcctttgcaagaaaa
ctgaaggatgttcatgagactcttggtttccctgttgcgtttgaatgtcgcatcaatggc
tcagaacctcttcaagtgtcttggtacaaggatggggtgcttttgaaagatgatgcaaat
ttgcaaacgtcttttgttcataacgtagcaacccttcagattttgcaaactgaccagagc
cacgttggtcagtacaattgctcagcttctaatcctcttggaactgcttcttctagtgcc
aaactcattctctcagaacatgaagtgcctcctttctttgatctaaagcctgtatcggta
gatcttgctcttggagaaagtggttcttttaaatgtcatgtaactggaactgcacccatc
aaaatcacttgggccaaagataaccgagagattcgccctggaggcaactacaagatgact
ttggttgaaaatactgccactctgacagttctcaaagtaagcaaaggcgatgccgggcag
tacacctgctacgcaagcaacgtcgctggaaaagactcttgttctgctcacctgggtgta
caagaaccacccaggttcattaagaagctagaaacttcaagaattgtgaaacaggatgaa
tacacaagatatgaatgtaaaataggagggtctccagaaatcaaagttttatggtacaaa
gacgagactgaaattcaagagagcagtaaattcagaatgtcattccttgactcggtggca
gtgttggaaatgcacaacctcagtgttgaggacagcggagactacacatgtgaggcccgc
aatgcagcaggcagcgcaagcagcagcacttccttaaaagttaaagaaccacctgttttc
cgcaaaaagcctcatcctgttgagacgctgaaaggagctgatgttcatctcgaatgtgag
cttcagggtactcccccatttcaagtttcttggcataaagataagagagaacttaggagt
ggcaagaagtacaagatcatgtctgagaacttcctgacaagtattcacatcctgaatgtt
gatgctgcagacatgggggaataccagtgcaaagccaccaacgatgtggggagtgacact
tgtgttggttctatcactctgaaagcaccaccaagatttgtgaagaagctcagtgatgtt
tctaccatcgttggtgaagaagttcagctacagactactattgaaggcgctgagccaata
tcagtggtgtggttcaaagataagggggagattgttagagaaagtgacaacatatgggtt
tcttattcagaaaacattgcaaccctacagttcgcaagagcagaaacagccaatgctggg
aagtacacctgtcagatcaaaaacgatgctggaatgcaagagtgcttcgccacactatcc
gttctcgaacctgcagcgattgtggaaaagccagaatccattagagttaccacaggagat
acctgtaccttggagtgcacagtcactggcacacccgaactcagtaccagatggtttaag
gatggaaaagaactgacaagtgacagcaaatacaaaataagcttcttcaacaaagtatct
ggccttaagattatcaatgttgcacctagtgacagtggtgtatacagtttcgaggtgcaa
aaccctgttggcaaagacagctgtacagcctcagttcaagtttcagaccgagctgttcct
ccttcattcacgagaaaattgaaagagacgaatggtctgtcgggttcctcagttgtaatg
gagtgcaaagtctatgggtcaccgccaatctctgtctcctggttccatgaaggaaacgag
atcagcagtggaaggaaataccagaccaccctgacagataacacttgtgctttaactgtg
aacatgctagaagaatcagatgccggagactacacgtgtgtagctactaacgtggctggt
tctgatgaatgcagcgctcctttgaccgtgcgagaaccaccatcctttgttcagaaacct
gaggccatggatgttttaacgggagccaatgtaactttcacaagcatcataaaaggaaca
cctcctttcagcgtcagctggttcaagggtagcagtgaattagtaccaggggacaggtgt
aatgtgtctctggaggattccgtggctgagctggagctgtttgatgtagagacaacacag
agtggagaatatacctgcatagtcagtaacgaggccggcagagcttcttgtacagcacat
ctctatgtaaaagcgccagccaaatttgtgaagaggctcaatgactacagcatagagaaa
ggaaaacccctgattctagagggcacgtacactggaactcctcccatttcggttacatgg
aagaaaaatggcataaacgtaactccttctcagaggtgtaatataaccacaactgaaaaa
tctgcaatcctggaaattccaagtagcacagtggaggatgcaggacaatacaactgttac
attgaaaatgcttctggaaaagattcctgttcggcacaaatactgatactagaaccaccg
tattttgtcaagcagttggagcctgttaaggtgaccgttggagattctgcctctttacag
tgccaaattgctgggacccctgaaattggggtgtcttggtacaaaggagataccaaatta
agacctacttccacctgcaaaatgcattttaggaacaatgtcgctacgctggttttcaac
caggttgatggtagtgatagtggagaatatatctgcagagctgaaaacagtgtgggagaa
gtttcttcatcaacgttccttactgttcaagagcaaaaactgccaccatcattttctcgg
caattgcgagacgttcaagaaacagttggactgccggttgtgtttgaatgtaccatacat
ggatcagagcctatctcggtgtcttggtataaagacggcaagccgttgaaagacagccca
aatgtacaaacatcgtttttagataatgtggccactcttaacatctttaaaacagaccgg
agccttgcgggccagtattcttgcacagctacaaatcctatagggtctgcttcttctggt
gccagactcattctcacagtggggaagaacccaccattctttgacatccctgttgcccct
gtggatgctgtggtcggggacagtgctgactttgagtgccacgttactgggacgcaacca
ataaaggtcgcttgggccaaagacaacagagagatacgaagtggcggaaactaccagatc
agttacctggaaaacacggcccacctgacaattctgaaagtagacaagggagactctggg
caatatacctgctatgctgtgaatgaagtgggaaaggactcatgcacagctcaacttaac
ataaaagagcggctcattccaccaagcttcactaaaaaactctcggagaccgttgaagag
acggaagggaattctttcagactcgagggccgtgttgccggttcccagcctataacggtc
gcatggtacaggaataatatcgagctacacccaacttccaactgtgagatcgcattcaag
aacaatacgctcctgctgcacgtcaagaaggcgggcatgggcgacgctggcctgtacaca
tgcaaagtgtcaaacgacgcgggctatgctctgtgtacatcttcgattgtcatcaaagaa
cccaagaagccccctgtgtttgatcagcaccttactccagtaacagcaatcgaaggagaa
tttgtgcagctcagctgtcacgtgtggggatcagaacccatcaggatccagtggctgaag
gctggaagggaagtaaagccctcagacagatgcagcttcagctttgctcacgggactgcc
atgctggaactgaaggatgtggctaaagcagattcaggagattatgtgtgcaaagcttca
aatgtggctggaagtgacacttcaaaatcaaaagtgaccattaaagacaaaccagccgca
gtcccagcagccaagaaagcggcagtagacgggaaactcttcttcgtgtcagaacctcag
agtatcagagtcgtagaaaaaaccactgcaacattcattgcaaaagttggaggtgatcca
atcccaaatgttaaatggacaaaagggaaatggaggcaactgaaccaggggggtcgcatt
cttatccaccagaagggcgacgaagcaaagctggagattagagacaccacaaaaactgat
tctggattgtatcggtgtgtcgcatttaataaacacggcgaaattgaaagtaatgttaac
ctgcaggtggatgaaaggaagaaacaggagaaacttgagggagatcttagagcaatgctg
aaaaagactccaattttaaagaaaggagctggagaagaagaggaaatcgatatcatggaa
cttctcaaaaatgttgatcctaaagaatatgaaaaatatgcccgcatgtatggaatcact
gacttccgaggtcttcttcaagcattcgaactgctaaagcaaagtcaagaagaagagaca
cacagattggaaattgaggaaattgagaagtcagagaaggatgaaaaggagtttgaggaa
cttgtatcatttatccagcaaaggctgtcacagacagagcctgtcactctgatcaaggac
attgagaatcagacagttttgaaagatgatgatgctgtgtttgaaattgacattaagatt
aattatccagaaatcaagctttcatggtacaaagggactgaaaaactggaacccagtgat
aaatttgaaataagtatcgatggtgatcgacatacactcagagtcaagaactgtcaactt
aaagatcagggcaattatagattggtgtgtggtccacacatcgctagtgctaaactaacc
gtaattgagcccgcttgggaacggcatcttcaggacgttactttgaaagaaggccagact
tgcaccatgacatgccaattttccgtgccaaacgtaaaatctgaatggttcagaaatggc
agaatccttaagccccaaggtagacataagacagaagtggaacacaaagtccataagctg
accatcgcagacgttcgggcagaagaccaggggcagtacacctgcaaatatgaagacctt
gaaacttctgcagagctcagaattgaagctgaaccaattcagtttaccaagcgcatacag
aacattgtggtgagcgagcatcagtcggccaccttcgaatgcgaagtgtcctttgatgat
gccattgtaacgtggtacaaagggccaacagaactgaccgagagccagaagtacaacttc
aggaatgatggtcgctgccattatatgaccatccacaatgtgaccccggatgatgaaggt
gtctattcagtaattgctcgactggaaccgagaggtgaagcaagaagcacagcggagctg
tacttaacaacgaaagaaatcaagcttgagatgaagcctcctgatattcctgactccaga
gttccaatcccaaccatgcctatcagagcagtacctccggaagaaatccctcctatggtt
gttcctcctattcctctgttgctaccatcacctgaagaaaagaaaccaccagcgaaacgc
attgaagtgaccaaaaaagctgtgaagaaagataccaaaaaagttgtcgcgaagcccaaa
gaagaacctaaagaggttgacaagaagcccctgcgtcctactgccttgattccagcaaaa
gctcctgaaattgttgatgtatcctccaaagctgaagaagtaaaaataacaaccataacc
agaaagaaagaggttcacaaagaacaagaagctgtgtatgagaagaagcgcgctgtctac
gaggagaagaaacttttcatcgagtctctggaagaaccttatgacgaactggaagtggaa
ccgtacacggaaccgtatgaggaaccttactatgaagaaccagacgaagactatgaggag
gccaaggtagaagcgaagagggaagttcacgaggaatgggaggaagacttcgaggaaggc
caggagtactacgaaagggaggaaggttatgacgaaggggaggaagactgggaggaaact
taccaagagagagaagtggtccaagtgcaaaaggaggtttatgaagaagcgcacgaaagg
aaaatcccagcaaaagtccctgaaaagaaagcaccgcctccaaaagttgtaaagaagcca
gtagttgaaaaaattgaaaagacttctcgaagagtggaggaacagaaagttcaagtcacc
aaagtacctgaagtttcaaagaagattgttccacaaaaaccttctcggactcctgtgcag
gaagaagttattgaagtgaaagtaccagctgtgcatacaaagaagatggttatttcagaa
gaaaagatgttctttgcttctcacgcagaggaggaggtgtcagtcacagtccccgaggta
cagaagaaaactgttaccgaagagaaaattcacgttgctgtttccaaaaagattgagcct
ccacctgaagtccctgaactacctaagaaaccagtcccagaagaagtggttgctgttccc
attcctaaaaaggtggaacccccaccagccaaagttcctgaagttcccaagaaacctgta
ccagaggagaaaaagcctgttcctgttcccaaaaaggaaccacctgctcccccaaaagtc
ccagaagtgccaaagaaacctgttcctgaagaaaagatacctgttcctgaagaaaagata
cccgttcctgttgcaaagaaaaaggaagtcccgccagctaaagttcctgaagtacagaag
aaggttgtcacagaagaaaaaataaccattgttactcaaagagaggaatcaccaccaccg
gcagtgccagaaataccaaagaagaaagttcctgaagaaaaaagacctgttcctcaaaaa
gaggaagaagttccaccaccaaaaggtattgtctctctttccaagaccaaacccgtccct
gaagagaaagttcctgtcccggttcctgtggctaagaaagctcctcctccccgagctgaa
gtttctaagaaaaccgtggtagaagaaaaaagattcgctgctgaagaaagactgtctgtt
gcagttcctcaaacagtggaagtcatgcgacacgaagtatccacagaggaggagtggagt
tattcagaagaagaggaaagagtatccgtttcagtttatagagaagaggaaagagaagag
gaggaagaagtgaaggttacagagtatgaagtgatggaagagcctgaggaatacgttgtg
gaagaaaaggtgcactttatctctaagagagtggaagccgagccagcagaagcggtggag
aagcatgagaagaaggttgtactgaaaccgaaaattcctgctaaaatcgaggagccccca
ccagcgaaagttcctggagtaccaaagaaacctgtgccggaaaagaaagtccctgctgca
gtccccaaagtggaaaaggtgccaccagtgccggaagagccaaagaagccagttccagaa
aaaagggttcctccaaaagtggctaagaaagaagaacctccccccaccaaagtgactgag
aggcacatgcaaattactcaagaagaagaagttcatgttgctgtaactaaaaaagaggag
cctccaagagcaagagtgcccgaggaacccaagagagctgttccagaagaaaaaattcca
aaactcaaacctaggagagaggaggaaccaccagcaaaagtcactgaactcagaaaaaga
gctgttaaagaagaaaagatatccattgaagttccaaaaagagaagctcctcccgtgaaa
gaagtcaccgtaactgcagagaaagcatggtcttacacccgggaagaagaaattgtttca
gtagagcgggaagaggaatatgatgaatatgaagaatatgattataaagaacttgagtat
gaaccaacagaagaatatgaccagtatgaagaatacgaggaacgtgaatttgaacattat
gaagagtataaagagcacgaagaatatgtcacagaacccaggaagcctctcccagtaaag
cctgtccaagaagaaccagttcccaccaagccaaaggccccaccagctaaagtgctgaag
aaaccagtccctgaagaaaaagtcccagtgcccattcccaagaaactcaaacctccacca
cccaaagtgcctgaagaatcaaagaaagttgttgaggaaaaaatacacatttcaattacc
aaacgtgagaaagagcagattgctgagccagctgttaaagagcccatcaagcccaagaga
gttgtcacagaagaaaaagtacttgttcctaaaaaagaagtaacagcacctgttagagtg
gcagaagtactaaaaagacaagaacaagaagagattgtctttgaagaggaagttgtaacc
cacgtagagaaatatttaaaagaagaagaagaagaatacattcatgaagaagaggaactt
gtaactgaagaagaagttgtaccagtgataccagtcaaagtgcccgaaatacccaagaaa
cctgtaccagaagagaagaaacctgttcctgttcccaaaaagaaggaagccccaccagca
aaagtgcctgaggttcctaagaagccagaggagaaagttcctgtgcccattcctaaaaaa
gagaagcctccaccagctaaagttcctgaagtgcccaagaaacctgtaccagaggagaaa
gtgccagtaccggttcctaaaaaggtggaagctccacctgccaaagtgccggaagtgccc
aaaaagccagtgcctgagaagaaggtgccagttcctgttcctaagaaggcagaggctcca
cctgcaaaagtgccagaggtgcccaagaagatcatcccagaggaaaagccaacacctgtt
ccgaaaaaagtggaagctccaccacccaaagtgccaaagaaacgtgagccagttccagtt
cctgtagctctacctcgggaagaagaagttccatttgaagaagaaattgctcctgaagag
gaagttctccctgaggaagaggaagttctccccgaggaagaggaagttctccccgaggaa
gaggaagttctccccgaggaagaggaagttcctcctgaggaagaggaagttcctcctgag
gaagaagttcctcctgaggaggaagaatttatacctgaggaagaagttgaacctgaagaa
gaggaagttcttccagaaattaaacctaaggtgccagtacctgcacgagtgcctgaggtt
aagaagaaagtgccagagaagaaagtggtcattcctaagaaagaggaggctcctcctgcc
ccagttcctgaggtacctaagaaagtggaagaaagacgaatcattctccctgaagaagag
gaagtgccaccagttgaagtgtatgaggagccggaagagcctattccagaagaagagatc
cctgaagaaccacctagcatagaagaggttgaggaagtggcgccacctagagtgcctgaa
gtggttaagaaagcagtacctgaggcacctactcctgttcctaaaaaagtggaggcaccg
ccagctaaagtgccaaagaaggttcctgaggaaaaagtgcctgttcctgttcagaaaaaa
gagccacctccagccaaagtgcctgaaaagaaagtcccagaaaagaaaatcgcagaaaag
aaagtccctgtgcctaaaaaagaagctgttcccccagctaaagggaggaccgtccttgaa
gaaaaaatatcagttgccttccacaaagaggaggtagtaagagagagaacagaattagaa
gtagtggaaacaccagtggaagtgcttgaggaagaagagttccatgaagttcaagaatat
tttgaagaagaagaattccacgaagtagaagaattcatcaaagtagaacgacctagagtt
gaagatgtacacagagctgaagaggtccacagggtaatagaagttttggagacagaagaa
gtggaagtatacgaaaaacccaaagctccacctaaagggcctgagatatctgagaaaatc
atccctccaaaaaaaccacccactaaggtcgttcctcgaaaagagccaccagctaaagta
cctgaagtgcccaagaaaattgtggtagaagaaaaagtacgtgttcctgaagagcccaaa
tttccaccagctaaagtgcctgaagttcctcaagaaattgttcctgaaaagaaagcacca
atggtgcctcccaaaaagcctgaagttgcacctgttacagtgcctgaggctcccaaagaa
gttgtccctgagaagaaggtgtctgtggcgcctcctaaaaagcccgaagtcccacctgtt
aaagtgcctgaggctcccaaggaagttgtccctgaaaagaaagtacctgtggcacctcct
aaaaagcccgaagtcccacctgttaaagtgcccgagcctcccaaagaagttgtccctgag
aagaaagtgtctgtggcgcctcctaaaaagcctgaagtcccacctgctaaagtgcccgag
gctcctaaagaagttgtccctgaaaagaaggtgcctgtgatgcctcctaaaaagcccgaa
gtcccaccagccaaagtgcccgaggtgcccgaggcagctgttccagaaaagaaggtgcct
gaagctgttcctcccaaaccggagagtcctccccctgcagtgtatgaggagcccgaggaa
gctgcctgggaagagcccacagcggaagttgtggaagagccagagcctgccgctcctcca
gaagtgaccatgccacccaagaaacctgtcccagaaaagaaaccacctgctgtcattgcc
aaaaaacctgaaccaccaccagtgaaagtgcccgaggtacccaaggaagttactcctgaa
aagaaggtgcctccagtggttcccaaaaaaccagaagtcccacctgctaaagtgcctgaa
gttccgaaagaagttgttcctgagaagaaagtaactgttcccaagaagccagaagtccca
ccacctaaagtgccagaggtgccaaagaaacctgccgtagaagaggaacccgccattcct
gctcccgaggaaggagagccccctgcagaagtatatgaagagcctgaggaagttgctccc
gaagaggaagagccagttcctgttgctgaagaggagccagaagccccaccaccagcagta
cctgaagaacccaagaagattgttccagagaagaaagttcctgtcatcaaaaaaccagaa
gctccacctcccaaagaacctgaacctgaaaagaaggttattgagaaaccaaaactcaaa
ccaaagcctgcggcacctcctcctgctccaccaaaggaagatgtgaaggagaaaatattc
cagcttaaagctgttccaaagaagaaagttcctgaaaaacctgaagttccagaaaaagtg
gagcttaagcctctgaaagcgcccggagttgaaaagaaagttcgcaaattacttcctgaa
cctaaacctcaaccaaaagaagaagttgttctcaaaagcgttctaagaaagaggcctgaa
gaagaagaacctaaagtagaacctaaaaaactagaaaaaattaaaaaaccagtaccagag
ccacctccgaaagctgttgaagaggctgaagtacctccagctgctgttaccaaaagggaa
aggaaagttcctgaaccagtaaaagtgcctgaaattaagccagcaatacctctccctgcg
cctgaaccaaaaccaaagcctgagccagaagtgaaaataatcaaaccacctccggtggag
cccccgcccacccccatcgccgccccggtgacggtgcccgtggtcggaaagaaagcagaa
gccaaagcacctaaggaggaggctgccaagccgaaaggtcccatcaaaggtgtcgccaaa
aagactccttcaccaatagaagctgaaaggaagaagttaagaccaggaagtggtggcgag
aagcctcctgatgaagccccattcacttaccagctaaaggctgtgcccctgaagtttgtg
aaagaaatgaaagacatcgtcttgactgaagcagagtcagtggggtcttctgccatcttt
gaatgtttagtctccccctccactgcaattacgagctggatgaaagacggtagcaatatc
cgtgagagcccaaagcacagattcatcgcagatggtaaagacagaaagctgcatatcatg
gacgtccagctgtctgatgccggcgaatacacctgtgtcttacgtttgggaaataaggaa
aagacctccacagctaaacttgttgtagaagaacttcctgtgcgtttcgtgaaaacactt
gaagaggaagtcaccgtggtcaaaggacagccgctgtacttgagctgtgagttaaacaaa
gagcgcgacgtagtctggaggaaggatgggaagattgtggtggagaaacccggcaaaatt
gtgcccggcgtcattggcttgttgcgagccctgaccatcaatgacgcagatgaccaagac
gctggaacatacacggttactgtggaaaatgccaacaacctggaatgttcatcctgcgtc
aaagtagtagaagtcatcagagactggctggtgaaaccaattcgagatcagcatgtgaaa
ccgaaggggacagctgtttttagctgtgtaatagcaaaggaaactccaaacattaagtgg
ttcaaaggatatgatgaaatcccgttggaaccgaatgataagactgagataatcagagaa
ggaaaacaactattcctcaaagtcaagaatgctaccccagaagatattgatgaatatgcg
gtggaaattgaagggaaaagataccccgcgaagctgacactcggagatcgtgaagttgaa
ttgcttaaaccaatagaggacgtcaccatttatgagaatgaaagtgcaagctttgatgca
gaaatctcagaggcagacattcctggacagtggaaactgaaaggagaacttcttcggccc
tcacctacctgtgaaatcaaagcggaaggtggaaaacgcttcttaactttgcacaaagtc
aaactggaccaagctggagaagtcctttaccaggcacttaatgcgtttaccactgccatc
ctgacagtaaaagaaatcgaacttgactttgttgtgcctctgaaggacgtcactgttccg
gaaaggcgacaagctcgatttgaatgtgtcctcactcgagaggcgaatgtgatatggtct
aaaggacctgatataatcaaggcatctgacaagtttgatatcattgttgatggaaagaaa
cacattcttgtcatcaatgattctcagtttagtgacgaaggggtttatactgctgaggtg
gcgggcaagaagagctcggcacgattatttgttacaggtataaggttgaaattcatatcg
cctcttgaagaccaaacagtgaaagagggcgaaacagcaactttcgtttgtgagctttct
catgaaaaaatgcacgtagtctggttcaaaaatgatgccaaactccacacgagcagaacc
gtactcatctcatctgagggcaagactcacaaactggaaatgagagaagtgacactggat
gatatatcccagataaaagctcaagttaaggacctgagctccaccgcaaacctgaaggtc
ttagaggccgatccctatttcactgtgaaattacatgacaaaactggagtcgagaaggat
gagattattctgaagtgtgaagtgagcaaagacgtgccagtgaaatggttcaaagatggt
gaagagattgtaccttcaacaaaatactctatcaagtcggatggcctgcgccgcgtccta
aaaatcaaaaaggcagaccttaaagataaaggcgaatacatgtgtgactgcggcaccgac
cagacaaaagcaaatcttaacattgaggcccgactgataaaagtggaaaaacctctgtac
ggagtagaattgtttgttggtgaaacagctcgctttgaaattgaactttctgaaccagat
gttcacggccagtggaagttaaaaggagagcctttaactgcttctcctgactgtgagatc
atcgaagatgggaagaagcatattctggtcctttacaactgccagctgcctatgacaggg
gaggtctccttccaggctgccaatgccaaatctgcagccaatctgaaagtgaaagaactg
ccactcatcttcatcacgcctctcagtgacgttaaagtctttgagaaagatgaggctaag
tttgagtgcgaagtgtcaagggagccgaaaacattccgttggctgaaaggaacccaggaa
atcacaggtgatgacaaagttgagctgataaaggacggcactaaacattccttggtgatc
aagtcagctgcttttgaagatgaaggaaaatacatgtttgaagccgaagataaacacaca
agtgccaaactgatcattgaaggaatccgactcaaattcctcaccccactcaaggatgta
acagccaaagagagggagagtgctgtgttcactgtgcatctgtcccacgataacatccgg
gttaagtggttcaagaacgaccagcgcctacacaccagcaggtcggtctggatggacgat
gaagggaagactcattccatcacattcagagacctcactatcgatgatacctctcaaatt
aaagtggaagctatggggctaagttcagaagctaaactcaccgtgcttgagggagatcca
tacttcaccggaaagcttcaagattacactggcgtagagaaagatgaagtgattctacag
tgtgaaattagcaaagcagacgcgccggtgaaatggtttaaggatgggaaggaaatagag
ccatctacaaatgtagttattaaggcagacggcaagaagcgtgtactcctcctaaggaaa
gccttgaaatcagatatcgggcagtatacctgcgactgtggcacagacaagacctcagga
aagctcaacatcgaagatcgggagatcaagctggtgcggcctctgcacagtgtggaggtg
atagagactgagacggcccgctttgaaaccgaaatctctgaggaggatatccatgccagc
tggaaactcaagggagaggcactactccaaacacctgattgtgagatcaaggaagaaggc
aaaatgcacttcctgattttgcacaactgccgcctggaccagaccggcggggtggatttc
caagctgccaacgtgaaatctagtgcccacctccgagtgaaaccacgagtaattggtctt
ctgaggcctctgaaggatgtcacggtgaccgcaggggagacagccacctttgactgcgag
ctctcttacgaggatatcccggtggaatggtatctcaaagggaagaaactggagcccagc
gataaggtggtcccacgttcagaaggaaaagttcatacacttactctaagggatgtaaag
ttagaagatgctggagaagtccaactaagagcaaaagatttcaaaactcatgccaatctc
ttcgtgaaagaaccccccgttgagttcactaagcctcttgaggaccagacggtcgaagaa
gaagccaccgcagtactagagtgtgaagtatccagagaaaatgctaaggtgaaatggttc
aaaaacgggacagaaattctcaaaagcaagaagtatgaaattgtggctgatggcagggtc
agaaaacttattatacacggctgtaccccagaggatattaaaatgtacacttgtgatgct
aaggattttaagacttcctgtaacctgaacgtcgtgcctcctcatgtggaattcttaaga
ccacttaccgatcttcaagttaaagaaaaagaaatggctcggtttgagtgtgaactttcc
agagcaaatgctaaggttcagtggtttaaagatggtgctgaaattaaaaagggcaaaaaa
tatgacatcatatctaagggagcagtgcgcattcttgtcatcaacaaatgtctcctggat
gatgaagcagaatattcctgtgaagtaaggacagcaagaacttctggcatgctgaccgta
ctggaagaagaagctgtctttacaaaaaatcttggcaacgttgaagttagcgaaacagac
actataaaactggtttgcgaagtctccaagcctggagcagaagtggtttggtacaaaggg
gatgaggagatcattgaaacagaaagatatgaaatccttaccgatggacgaaagagaatc
ctgaccattcagaacgctcatcttgaggatgctggcagctacaactgccgactcccaagt
tcccgaactgatggcaaagtcaaagtacatgaacttgctgctgaatttatctcaaagcct
caaaaccttgaagtacttgaaggagaaaaggctgaatttgtctgcactatatcaaaggaa
agctttgaagtccagtggaagagggatgataagacacttgaatctggagacaaatatgac
atcattgctgatggcaaaaagaggatcctggttgtgaaagatgccacattacaagatatg
ggaacttacgtagtcatggttggagccgccagagcagcagctcacttgacagtaattgaa
aaactcaggatcatagttcctcttaaggacactcgtgtaaaggaacaacaagaagtcgtc
ttcaactgtgaagtcaatacggaaggtgccaaggccaaatggttcagaaatgaagaggcc
atatttgatagttcaaaatacattattctccagaaagacctggtctacaccctcagaatt
cgaaatgcacaattagatgatcaagccaattatagtgtgtctctgaccaatcacagaggt
gaaaatgttaagagtgctgctaatctaatagtagaagaggaagaccttaggattattgag
cctcttaaagatattgaaacaatggagaagaaaacagtcacattctggtgcaaggtgaat
cgcctcaatgtaacactgaagtggactagaaatggagaagaggtgcctttggacaaccgg
gttttatacagaattgataaatataagcactctctaatcattaaagactgtggcttccct
gatgagggtgaatacatggtcaccgctggacaagataaatctgttgccgatcttctgatc
atagaagccccgacagaatttgtagagcacttggaagaccagacagtcactgagtttgat
gatgcggtcttctcctgccagctctccagagagaaggcaaatgtgaaatggtacagaaat
ggaagagaaatcaaagaaggcaaaaaatacaaatttgaaaaagatggaagtacacataga
ctcattataaaagactgcaggctggatgatgagtgtgaatatgcttgtggagtagaagac
agaaaatctcgagccagactttttgtggaagaaatccctgttgagatcatcaggcctccc
caagatattctcgaagcccctggtactgatgttgtcttttgggctgagctcaacaaagat
aaggtggaagttcagtggctaagaaataacatggttattgttcagggtgacaaacaccag
atgatgagtgaaggaaagatacacaggctacagatttgtaatattcaacctcgtgaccag
ggtgaatacagatttattgccaaagacaaagaagccagagctaagcttgaactggcagct
gcacctaaaatcaagacagaagatcaggatcttgtggttgacgttggccagcctctgacg
atggtggtgccctatgatgcctaccctaaagcggaagctgagtggtttaaagaaaatgaa
cctctgtcttcaaaaactgttgaaactacagctgaacaaacttctttcaggattttagaa
gctaagaaaggagacaaaggaaggtataaaattgtgcttcagaacaaacatggaaaagca
gaaggattcatcaatttaaaagttattgatgtcccagggccagtacgtaacttagaagtg
acagaaacatttgatggtgaagtaagccttggttgggaagagccattaaccgatggtgga
agcaaaatcataggttatgttgttgaaagacgtgacatcaaaaggaagacgtgggttctg
gccactgatcgtgcagacagttgtgagtttactgtcactggactacagaaaggtggagtt
gagtacctattccgtgtcagtgcaaggaacagagttggcactggtgaaccagtagaaaca
gataaccctgtagaagcaaggagtaaatatgatgttccaggccctcctttgaacgtagcc
atcactgatataaatagatttggggtctcactgacatgggagccaccagagtatgacgga
ggagctgtgatcacaaactacgttattgaattaagagataagacttctatcagatgggac
actgccatgacagtaagagctgaagacctatctgcaactgtcactgatgtggtggaagga
caagattacagtttccgggtcagagcccaaaaccgaattggagtggggaaaccaagtgcg
gccacgccctttgtcaaagttgctgatccaattgagagaccaagtcctcctgtgaaccta
acttcctcagatcagactcagtcatcagttcagctcacatgggagcctcctctgaaagat
ggaggaagcccaatattgggttacataattgaacggtgtgaagaaggaaaagataattgg
attcgttgcaataagaaacttgtccctaaactgacttaccaggttactggattacaaaaa
ggaaataaatacttatatcgagtatctgcagaaaatgaagctggtgtttcagatccatct
gaaattcttggtcctctaactgctgatgatgcatctgttgaaccaacaatggatttaagt
gcatttaaagatggcctggaagttattgtcccgaatcctatcacgatcctggttccaagt
acaggctatccaaggccaagtgcaacctggtcttttggagataaagtactagaagcagga
gaccgtgtgaaaataaaaaccttatctgcctatgctgaacttgtcatttctccaagtgaa
cgtccggacaagggcatttatacactgaaattagaaaatcgcgtgaaagcaatttctgga
gaaattgatgtcaatgtaattgctcgcccaagtgcacccaaagaactgaaatttggtgac
ataaccagagactcggtacatttgacttgggaaccaccagatgatgatggaggaagtcca
ttaactggatatgttgttgaaaaacgagaagtcagccggaaaacatggactaaagttata
gactctgtgactgacctagaattcacggttcctgatcttgttcaaggaaaagagtattta
tttaaagtctgtgctcgtaacaaatgtggccccggagaacccgcatatgttgatgaacct
gtaaatatgtcagttcctgcaacggtacctgacccaccagagaatgttaaatggagagat
cgaacagccaacagcatctttctaacatgggatccacctaaacatgatggtggttcacgc
gtcacaggctatatagttgaaaaatgtccacgtggctctgatcgatgggttgcctgtgga
gaaccagttgcagaaacaaaaatggaagtgacaggtcttgaagaaggtaaatggtatgcc
taccgcgtgaaggccttgaacaggcaaggtcctagcaaaccaagcaaacccacagatgaa
atccaggctgtggatacacaggaggccccagaaatcttccttgacgtgaagctcctcgct
ggtctcaccgtaaaagcaggaactaaaattgaacttcctgccactgtaactggaaaacct
gaacctaaaataacttggacaaaggccgatatgcttttgaagcaggacaaaagaatcacc
attgaaaatgttcctaagaaatccacggtgaccatcatggatagtaagaggagtgacacc
ggcacatacatcatcgaggccgtgaacgtctgtggtcgggccactgcggtggtggaagtg
aacgtcttagacaaacctggaccaccagctgcttttgacatcacagaagtgaccaacgaa
tcatgccttctaacatggaacccaccacgcgatgacggtggatctaaaatcacaaactat
gttgtggagagaagagcgacggacagtgaagtgtggcacaagctctcatcaactgtcaag
gatacaaactacaaggcaaccaaattaacacccaacaaagaatacatcttcagagtggct
gcagaaaacatgtatggtgttggtgaaccagttcaagcctctccaataacagctaaattt
cagtttgatccacctggacctccaactcgcctcgaaccttctgatatcactaaagatgca
gttactctcacatggtgtgagcctgatgatgatggtggcagcccaatcactggatactgg
gttgaaagattagatcctgatactgataaatgggtcagatgcaataagatgccagtaaag
gacacaacatatagagtgaaaggtctcaccaataagaaaaaatacagattccgtgtgttg
gctgaaaatctggctggacctggaaaaccaagtagaacaactgaaccaatcttaataaag
gatcccatagatcctccatggcctcctggaaaaccaactgtgaaagatgtaggaaaaaca
tcattgatgttgaattggacaaagccagaacatgatggaggggcaaagattgagtcttac
gtcattgaaatgctaaagaccggaacagatgactgggtccgagtggctgaaggtgttccc
accactcagcatttgctcaccggtctcatggaagggcaggaatactcattccgagtcaga
gctgtaaacaaggctggagaaagtgagcccagtgaacccagtgaccctgtgctttgcagg
gaaaaactatatcctccatcaccacctcgctggcttgaagttattaatatcacaaaaaat
acagcagaccttaagtggacagttcctgagaaagatggagggtcccccatcaccaactac
attgtggaaaagagagacgtgaggcgaaaaggctggcaaacagtggacacaactgtcaag
gacaccaagtgcaccgtaaccccactgacagagggctctttatatgtgttccgagttgct
gcagaaaatgccataggacaaagtgactactgtgaaattgaggactctgtcctggccaaa
gatacctttaccacccctgggccaccctacgctcttgcagtggttgatgtaaccaagcga
catgttgacctgaagtgggaaccaccgaaaaatgatggtggacgaccaatacagagatat
atcattgagaagaaagaaaagttaggtacccgttgggtgaaagctggaaagaccgcagga
cctgactgtaacttcagagtaactgatgtcattgaaggaacagaggtccagtttcaggtt
cgggcagaaaatgaagcaggcgttggtcacccaagtgaacccacagaaatcctggcaatt
gaagatccaacaagtcctccttcacctccccttgacttgcatgtgactgacgctgggcga
aagcacattgccattgcctggaagcctccagagaaaaatggtggaagtcctattatagga
taccatgttgaaatgtgtccagtaggcactgagaaatggatgcgagttaattctcgcccc
ataaaagacttgaaattcaaagttgaagaaggcgttgttcctgacaaggagtacgttctg
agagtgagagctgtcaatgctgttggtgtcagtgagccatctgaaatctccgaaaatgtg
gttgccaaagacccagactgcaagccaacaattgacatggagacacatgacattgttgtt
attgaaggtgaaaagttaagcattcctgttcccttccgggctgtcccagttccaaccgtt
agttggcataaagatggcaaagaagtcaaagcaagtgatagattaacaatgaagaatgac
cacatctctgcacaccttgaagttcccaagtgtgtccatgcggatgctggagtttatacc
attacgctggagaacaagctcggctcagcaactggaaaaatcaatgtcaaagtcataggc
ctacctggaccatgcaaagatattaaagcaagtgacgtgaccaagagttcttgcaaatta
acctgggaacctccagaatacgatggtggaagcccaatccttcattacgtcctggaacgc
agagaggctgggaggaggacatatataccagtcatgtctggtgagaacaaactgacttgg
accgtaaaagatctcataccaaacggtgaatacttcttccgtgttaaagctgtcaacaag
attggtggaggcgaatatattgaactgaaaaatccagtcattgctcaagatccaaagcag
ccccctgatccacctatagatgttgaggttcataatcctacagctaaggcaatgactatt
acgtggaagccgcctttgtacgatggagggagcaaaataatgggttacatcatagaaaag
attgctaagggtgaagacaaatggaagagatgcaatgaacacctagtacctgtcctgacc
tatacagcaaaaggacttgaagagggaaaggaataccaattccgagtgcgagcagaaaat
gctgctggcattagtgaaccttctcgggccactcctccaaccaaagctgtagatcctatt
gatgccccgaaggtcattatgagaacaagccttgaagtgaaacggggtgatgaaatagca
cttgacgcaaccatctccgggtcaccttacccaactattacgtggctaaaggatgaaaaa
gtcattacaccagaagaaattaagaagcgagtagcacccacaattaggaggaagaggggt
gaagttcaagaagaagaggaaccatttgtcctgcagctgacagaacgtttgagtatcgac
aacagtaaaaagggagaatctcagctacgcgtccgagattctctccgacctgaccatggc
ctgtatatgatcaaagctgaaaatgaccatggtattgccaaagctccttgtactgtctgt
gtgctggatacaccgggaccaccaatcaactttgtatttgaagatattagaaagaactcc
gtcctctgtaaatgggaaccaccccttgatgatggcggcagtgaaattataaactacact
ttggaaaagaaagacaagacaaaacctgactcagagtggattactgtcacttcaacactt
agacactgcaaatactcagtgacaaaactgattgaaggaaaagagtacctcttccgtgta
agagctgaaaataggtttgggcctggaccaccatgtgtttcaaagccacttatagctaaa
gatccatttgaaccacctgatgcacccgataagcccattgtagaagatgtaaccagcaac
agtatgctagtgaaatggaatgaaccaaaagataatggaagtcccatcttgggttattgg
cttgaaaaacgtgaggttaatagtacacattggactcgtgtcaacagaagccttctgaat
tctttgaagaccaatgtagaaggcctattagaaggactcacctacgtcttcagagtatgt
gccgaaaatgcagctggacctggaaagttcagtcccccttcagatcccaaaacagcacgt
gatccaatctctccaccggggccacctgtcccaagagtcacggacacaagctctacaact
attgatctagaatgggaacccccagctttcaatggtggtggggaaattgttggctacttt
gttgataaacagctggttggcacaaatgaatggtcacgctgcacggagaagatgatcaag
ccccgtcagtacactgtcagagaaatccgagagggtgccgattataaacttcgagtgagt
gctgtcaacgctgcaggtgaaggaccaccgggagagacaggacctgttactgtggctgaa
ccacaagagcctccgaccgtggaactagatgtttctgtcaaagctggaatacaaataatg
gctggaaagactctgagaattccagctgtggtaactggtcgtccggtgcctaccagagta
tggaccatagaagaaggggagctggataaagaccgcgttgtaatagagaacgttggaaac
aaatctgatctaattatcaagagtgcattgagaaaagatcatggcagatacgtgatcaca
gctaccaatagctgtggttccaaatccgcggcagccagagtagaagtttttgatgttcct
ggaccagttcttgacttaaaacctgttgtaacaaacagaaagatgtgtttacttaactgg
tctgatcccgcagatgatggaggaagtgaaatcacaggattcattattgaaagaaaagat
gctaagatgcatacctggagacaaccaattgagactgagagatctaaatgtgacatcaca
ggcctcattgaggggcaagaatatatgttccgtgtgattgccaagaacaagtttggctgt
ggccctcctgttgaagtaggaccaattcttgcagttgatccactaggtcctccaacgtct
cctgagaggctcacatacacagaaaggacgaagtccactatcacccttgactggaaagag
ccccgcagtaacggtggcagtcccatccaaggctatatcattgaaaaacggcgtcacgac
aaacccaactttgaaagagttaacaagcaactctgcccaaccacatctcttctggttgaa
gatctcgatgaacaccaaatgtatgaattccgcgtcaaagccgtcaatgcagttggggaa
agtgaaccatccctgcctcttaatgtggtcatacaagacgatgaagtgcctccaactatt
aagttgcgcctgtctgttcgaggagacactatcaaagttaaggcaggagagcctgttaat
atccctgcagatgtgacaggccttccgatgcctaagattgagtggtccaagaatgaaact
gtgattgaaaaacccacagatgcacttaagataacaaaggaagaagtatcccgaagtgag
gcaaagaccgagcttatcattcccaaagccgtccgggaagacaaaggcacttacaccatt
actgcttccaatcgcctgggctcagtgttccgaaacgttcatgtggaagtatatgatcgt
ccatcaccaccaagaaatcttgctgttactgacattaaagctgaatcttgctacttgaca
tgggatgcccctctagacaatggtggcagtgaaatcacccattatgtcattgacaaacgt
gatgcaagcaggaagaaaagtgaatgggaggaagtcaccaactctgctgtagagaggaaa
tatggggtctggaaacttatccccaacggtcagtatgagttccgagttagggcagtgaat
aaatatggaatcagtgatgactgcaaatcagataaagttgtcattcaagatcccttccgc
ctccctggacctccgggaaaaccaaaagttctggagcgcaccaaagggtcgatgctagtg
agctggactcctcctctggacaatggaggctctccaattacgggctactggctggaaaag
cgagaagagggaagtgcctactggtcacgtgttagccgagcaccaataaccaaagtggga
ttgaaaggcgtggaattcaacgttccccgcttgattgaaggtgttaaataccagttcaga
gcaatggcaataaatgctgcaggagttggtcctcccagtgaaccatcagatccagctatt
gcaggagatcctatatatccacctgggccaccttcttgcccagaggtcaaagataaaaca
aagtccagcatctcgctggcatggaaacctccagccaaagatggtggcagtccaatcaaa
ggctacattgtagagatgcaagaagaaggcagtactgactggaaaaaagtaaatgagcca
gacaaactgctaaccacctgtgaatgtgtggtgccaaatctgaaagaactccgcaagtac
agattcagagtgaaagctgtcaatgaagccggggaatccgagccaagcgatacaactgga
gagatccctgccacagacattcaagaggtaccagaagtttttattgacattggagcacaa
gactgtctggtttgtcaagctggctcccaaattaggattcctgctgtcatcaagggacgc
ccaacaccaaaatcatcgtgggagtttgatggaaaggcaaagaaggcagtgaaggaagga
gttcatgacgtacctgaggatgcacaggtggagactgctgaaaactcatcagtaattatt
attccggaatgcacacgagctcactcaggcaaatacagcatcacagccaagaataaagca
ggacagaagacagcacattgcagagtcaaagtcatggatgtaccagggccacccaaagat
ctgaaagtcagtgacatcacaaggggtagttgcagactcacatggaagatgccagatgac
gatggaggagacaggatcaaaggctatgttatagagaagaagacaatcgatggaaaagcc
tggactaaggtcaatccaaactgtggaagcaccacatttgtggttcctgatctcatctct
gaacagcagtatttcttccgcgtgcgtgcagaaaaccgttttggtgttggtccacctgca
gaaaccgttcagaggaccacagccagagacccaatatatcctcctgacccccccattaaa
ctcaagattggcctcataacaaagaacaccgtacacctatcatggaaacccccaaagaat
gacgggggctcccctgtcacccactatattgttgagtgccttgcatgggaccctactggg
aaaaagaaagaggcatggaaacagtgcaacaagcgtgatgtggaagaactggaatttact
gttgaagacctcattgagggcggccagtatgaattcagggtcaaggctgtcaacgctgca
ggagtcagcaaaccttcagccactgtgggcccagtgactgtcaaagaccagacatgccca
ccatcaattgagctaaaagaattcatggaggttgaagaaggaacggatgttaacattgtg
gccaaaattaaaggtgtgccattcccaacactgacctggtttaaagctcctccaaggaag
cctgacaagaaagaacctgttgtctatgacacccacgtcaacaaactggtagtggatgat
acgtgcaccttagttattccacagtctcgcaggagtgacactggcttatataccatcaca
gctgtgaataacctgggaacagcatcaaaggagatgagactgaatgtcctcggtcgtcct
ggccctccagtgggcccaataaagtttgaatctgtttcagcagatcaaatgacattatct
tggcttccacctttggatgatggagggtctaagattacaaactatgtaattgagaagaga
gaggctaataggaagacatgggtgcatgtctccagtgaacctaaagagtgcacgtacaca
attcccaaattgctagaaggccatgaatatgtgttccgaatcatggcccagaacaaattt
ggtgttggggagcctcttgacagtgaacctgaaacagcgagaaacctcttctctgtccct
ggagcaccagataaaccaaccgttagcagtgtgactcgcaactccatgactgtcaactgg
gaagagccagaatatgatggaggctctcctgtgacagggtactggctagaaatgaaagac
accacttcaaagagatggaagagagttaaccgagatcctatcaaagccatgactttgggt
gtttcttataaagtgactggtcttattgaaggttctgattatcagttccgtgtatatgca
atcaatgctgctggtgtgggccctgcaagtctgccatcagacccagtgactgctagagat
ccaattgcccctcctggtcctccaattcccaaagtcacagactggactaaatcatctgtg
gatttggagtggtctcccccactaaaagatggtggatccaaagtaactgggtacatcgtt
gaatataaagaagaaggaaaagaagaatgggaacagggtaaagataaagaagtgagagga
acaaagcttgttgtgacagggttaaaagaaggagctttctacaaattcagagttagagca
gtcaacattgccggcattggagaacctggagaagtcacagatgtcattgaaatgaaggac
agaattgtgccacctgaccttcagctagatgccagtgtcagagacagaattgtggtccac
gccggaggggtgatccggatcatcgcctatgtgtctggaaaacctcctccaactgtcacc
tggaacatgaatgaaagagcattacctcaagaagctaccattgagaccacagccattagc
tcctccatggtcatcaagaattgccagaggagccaccaaggtgtctactcccttcttgcc
aaaaatgcagggggagaaagaaagaagaccattatcgttgatgtattagatgtgccaggt
cctgttggaacaccattccaggctcacaacctaaccaatgactcctgcaaactgacgtgg
ttttctccagaagatgatggaggctctccagtcaccaattatgtcattgagaagcgtgaa
tctgaccgcagagcatggaccccagtgacatatacggttacccgacaaaatgctactgtc
caaggtctcattcaaggaaaagcctactttttccgaattgcagccgaaaacagtgttggc
ataggcccgtttactgagacaccaactgcacttgtcatcagagatccaataactgtacca
gagcgtcctgaagatctggaagtcaaagaagttactaaagattctgttactttgacttgg
aatcctcctaagtatgatggtggatcagaaattattaactatgtcgtagagagccgactc
attggaactgagaagttccacaaggttacaaaggacaacttgcttagcagaaaatacacc
gtgaaaggcttaaaagaaggtgatacctatgagtaccgtgtcagtgctgtgaatattgtt
ggacaaggcaaaccatcattttgtaccaagccaatcacttgcaaggatgacctagctcct
ccaacgcttgaccttgacttcagagataagctcacagttcgggttggtgaagcttttgcc
ctcactggccgttactcaggcaaaccaaagcctaaaatcacttggttcaaagatgaagct
gatgtgctggaagatgatcgcactcacataaagaccactccgacgacacttgctctagag
aagatcaaggccaaacgttcagattctggcaaatactgtgtggttgtggagaacagtaca
ggctctaggaaaggtttctgtcaagtcaatgttgttgaccgtcctggaccaccagtagga
ccggttatttttgatgaggtgaccaaagattacatggttatctcttggaagccaccttta
gatgatggaggcagtgaaattaccaattacattattgagaagaaggaggtgggcaaagac
atttggatgcctgtgacatccgcaagtgctaaaacaacatgcaaagttcctaaactcctt
gaaggaaaagattatattttccggatatatgctgaaaacctgtatggaataagtgatcct
ctggtgtctgattccatgaaagccaaagatcgtttcagggttcctgatgcacctgagcag
ccagttgttacagaagttaccaaagactctgcattagtgacctggaacaagccaaatgac
ggaggaaagcccatcaccaactacatcctggagaagagggaaactatgtctaaacgatgg
gctagagttaccaaagagcccatccatccatacactaaattcagggttcctgatcttcta
gaagggtgtcagtatgaattccgggtttctgcagaaaatgaaattggtattggagatcca
agcccaccatccaaaccagtctttgctaaagatccaattgctaaaccaagtccacctatt
aaccctgaggcaattgatacaacatgtaattcagttgatctaacctggcagccaccacgt
catgatggtgggagcaagattctgggttatattgttgagtaccagaaagttggagatgaa
gaatggaagagagctaatcacactcctgagtcatgtcctgaaacgaaatataaagtcact
ggtcttcgggatggtcaaacctataagttcagagtcagggcagttaatgaagctggtgaa
tcagatccagctcatgttcccgagccagtgctagtaaaagacagacttgaaccccccgag
ttgattcttgatgccaacatggcacgagaacaacacataaaggttggtgatactctaaga
cttagtgccgtcatcaaaggcgtgccattcccaaaagtaacttggagaaagggagacaga
gaggctccgactaaagcaagaattgatgttactccagttggtagcaagcttgaaattccc
aacgctgcccatgaagatggtggaatttattctttaacagtggagaatccagctggttcg
aaaactgtctcagtaaaagtcctcgtattagataagccggggccacctagagatctggaa
gtcagtgaaattaggaaagattcttgttaccttacttggaaggaaccactggatgatggt
ggttctgtcattacaaattatgtggttgagaggagagatgttgccagtgcccagtggtca
cctctttcagctacatccaagaaaaagagtcacatggctaaacaccttaatgaaggcaat
cagtatctcttccgggtagctgccgagaaccagtatggacgtggtccttttgttgaaaca
cctaaacccatcaaggctctggatcctctacatcccccagggccacccaaaaacttacac
catgtagatgtcgacaagactgaagtctcccttgtttggaataagcctgatcgtgatggc
ggctctccaatcactggatatttggtggaatatcaagaagagggcaccgaagactggatc
aagttcaagactgtgacaaacttagagtgtgttgttactggactgcaacaagggaagacc
tatagattccgtgtaaaagctgaaaatattgtgggtcttagtctccctgacacaactatc
ccaatagaatgtcaagaaaaactagtgcctccatctgtggagctagatgtgaaattaatt
gaaggccttgtggtaaaagctggaactacagtcaggttccctgccatcataagaggtgta
cccattcccactgccaagtggacaaccgatgggagtgagatcaaaacagatgaacactac
acagttgaaactgacagcttctcatcagtacttaccattaagaactgcttaaggaaagac
actggggaatatcaaatcacagtttccaatgcagctggcaccaaaacagtagctgtacat
cttactgttcttgatgttcctggtccaccaacaggtcctattaatattctggatgttacc
cctgaatatatgactatctcatggcagccacctaaggatgacggaggaagccctgtgata
aattatattgttgagaaacaagatacaaggaaaggcacatggggtgttgtttcatcagga
agcagtaagacaaagctgaaaatcccacatctgcaaaaaggctgtgaatatattttccga
gtcagagcagagaataagatgggtgttggccctccccttgactccgtacctactgttgct
aaacataagtttagtcctccatctcctcctggtaaaccagtggttactgacgttactgaa
aatgctgcaacagtgtcttggactctgccaaaatctgatggtggcagtccaataattggt
tactatgtggaacgtcgagaagtaactgggaaatgggtgagagtcaacaaaacacccata
cctgacctgaagtttagagtgactggactgtatgagggaaacacatatgagtttagggtt
tttgctgaaaatcttgcaggactaagcaatccatcaccaagttctgacccaataaaagct
tcccggcccatcaaaccacctggaccacctattaatcctaaactgaaagacaagaccaaa
gaaacagctgacttggtgtggacaaagcctctcagtgatggtggtagccccattctaggc
tacgtagtggaatgtcagaaacctggtacaacacagtggaataggattaataaagatgag
ctcattaggcagtgtgcctttagggtacccggactaattgaaggaaatgagtacagattc
cgtataaaggcagctaatattgtgggagaaggagagccaagagaactagcagaatctgtg
attgcaaaagacatccttcatcctccagaagtagaacttgatgtaacttgtcgtgatgtt
attactgttagagtgggccaaactatccgcattcttgctcgagtcagaggcagacctgat
ccagacataacttggtccaaggaaggcaaagtattggtccgagaaaagcgggttgacata
attcaggatctacctcgtgttgagttacaaattaaagaagctgttagagctgatcatggc
aagtatattatctcagctaagaataccagtgggcatgcccaaggttccgccattgttaat
gttcttgacagacctgggccttgccagaatttaagggttagcaatgtaaccaaagagaac
tgtacaatttcttgggaaaacccactagataacggtggctcagaaataacaaatttcata
gtggaatatcgcaaaccaaaccagaaaggctggtcaattgttgcttcagatgccactaag
cgattaattaaggccaacctcttagccaacaatgaatactatttccgagtttgtgcagag
aataaagtaggtgttggtccaaccattgaaacaaaaactccaattctggctattaaccct
attgatagaccaggtgagcctgaaaaccttcacattgcagataaaggaaagacatttgtc
tatctcaagtggcggcggcctgattatgatggtggtagcccaaatctgtcctatcacgtt
gaaaggaggctgaagggctccgatgaatgggaaagagtacataaaggaagcattaaagaa
acccaatatatggttgacagatgtgttgaaaaccagatttatgagttcagagtgcaaaca
aagaatgaaggtggggaaagtgactgggtgaagacagaggaagttgttgtgaaagaagac
ttacagaaaccagtacttgatctgaaattaagtggtgtgctaacggtcaaagcaggggac
accattagacttgaggcaggtgttagaggcaaaccattccccgaagttttatggaccaag
gacaaagatgctacagacttaacaagatcaccaagggtcaagattgataccagtgctgat
tcatccaaattttctctttctaaagcaaagcgaagtgatggcggtaaatatgtaattaca
gcaactaacacggctggcagttttgtggcctatgccactgtcaatgttttagataagcct
ggtcctgtaagaaatctgaaaattgttgatgtgtccagtgatcggtgtactattcgctgg
gacccaccagaggatgatggtggctgtgaaatccaaaattatattctagaaaaatgtgag
agtaagcgaatggtttggtctacctattctgctaatgtcttaacacccggtgctacagta
acacgtctcatagaaggaaatgaatatattttcagagtccgtgcagaaaataaaataggc
acagggcctccaacagaaagtaaaccagtcattgcaaaaaccaaatatgacagacctggt
cgtccggatcccccagaagtcaccaaagtaagcaaagaagagatgactgtggtttggaac
ccacctgaatatgacggtggaaaatccatcacaggatactttttggagaaaaaggaaaaa
cattcagtacgatgggtccctgttaacaagagtgcaatccccgagagacgtctcaaggta
cagaacctcctcccaggacatgaatatcagttccgtgtcaaggcagaaaatgaaattgga
gttggagaaccaagcttgccctcaaggccagtggtggcaaaagaccccatagaaccacct
ggtccaccaaccaatctcaaagtggtcgacacaaccaaaagttccataactcttgggtgg
ggaaaaccagtgtacgatggtggcgcgccaataattggatacattgtggaaatgagacca
aaacgagaagacacatcacctgatgaaggctggaaaaggtgcaatgctgcagcacaactt
gttcgcatggagttcacggttaccagcttggatgaaaaccaggaatatgagttccgggtg
tgtgcccaaaaccaagctggcattgggcgccctgcagaactaaaggatgctattaaacct
aaagaaatcctagaacctccggagattgatttggatgccagcatgagaaaactggtcaca
gtgagagcgggatgccctatccgactatttgccatagtgagaggacgaccagctcctaaa
gtcacttggcgaagagtgggtattgacaacgtggtcagaaaaggacaagtcgatctggtt
gacactatggccttccttgtcatccccaattccacccgtgatgactcgggaaaatattcc
ttgacgcttgtgaacccagcaggagaaaaggccgtgtttgtgaatgtcagagtattagat
actcctggtcctgtgactgatttaaaagtttcagatgtcactaaaacgtcatgccacgtt
tcctgggcccctcctgagaatgacggtgggagccaagtgacacattatattgtggagaag
cgtgaggcagagagaaagacgtggtcaacagttaccccagaagtcaagaaaacgagcttc
caagtcaccaacctcgtccctgggaacgagtacttcttcagagtcactgctgtcaatgaa
tatggccctggcgtgccagcagacgtccccaaaccagtgcttgcatcagatcctctgagc
gaaccggatccccccaggaaactagaagtcactgaaatgaccaagaacagtgctacctta
gcctggttacctcccctgcgtgatggaggtgctaaaatcgatggctacatcatcagctac
agagaagaggagcagcctgcagatcgctggacagagtactcggtggtaaaagatctcagc
cttgtcgtcactggcctcaaggaaggaaagaagtataaatttagagtagcggccagaaac
gctgttggagtcagtttgccaagggaagctgaaggagtatatgaagccaaagaacagctg
ttgcctccaaagatccttatgccagagcaaattactattagagctgggaagaaactccga
gttgaagcccatgtgtacgggaagcctcatccagtctgtaaatggaaaaaaggagaagat
gacgttgtcacttccagccacctggcagtgcataaagcagacagctcttcaatcctgatc
ataaaagatgttactaggaaagacagtgggtactacagcctcaccgcagagaacagttct
gggacagacactcaaaaaatcaaagttatcgtcatggatgctcctgggccccctcagcct
ccgtttgacatttctgacatagacgctgatgcttgctccctgtcatggcacatccctctg
gaggatggaggcagtaacatcaccaattacatagtggagaaatgtgatgtgagccgaggg
gactgggtgacagctctagcctcggtgacaaaaacttcctgcagagttggaaaactgatc
ccaggccaggagtatatcttccgggtccgtgctgaaaatcgatttggcatttcagagcct
ctcacatctccaaagatgctagctaagttcccatttggtgttcctagtgaaccgaagaat
gcacgagtcactaaagtcaacaaagactgcatatttgtggcatgggacagaccagacagt
gatggagggagtcccattactggttatctgattgaacgcaaagaaagaaacagtttgctc
tgggtgaaagctaatgatactcctgtccggtcaaccgaatatccttgtgctggccttgta
gaaggtcttgagtattcattcagaatctatgcactaaacaaagctggatccagcccaccc
agcaaaccaacagaatacgtaaccgcaagaatgccagttgatcctcctggaaagcctgaa
gttattgatgtttccaagagtactgtatccctcatctgggctcgtccaaaacatgatgga
ggcagcaaaatcattggctactttgtagaagcttgcaaacttcctggtgataagtgggtg
cggtgcaatacctcacctcaccagattccccaggaagagtacacagtcactggcttagaa
gagaatgctcagtatcaatttagagcaattgccaagactgcagtaaacattagcctgccc
tctgaaccttctgatccagtgaccatccaggcagaaaatgttccccccaggatagaactg
agtgtggctatgaaatctttgcttactgtgaaagctggaactaatgtttgcctggatgct
actgtttttggtaaaccaatgccaaccgtctcttggaagaaggagggcacactactgaaa
ccagcggaaggcataaagatggccatgaagcggaacttatgcaccctggagctgttcagt
gtgaaccgaaaggactcaggcgactataccattactgccgaaaatgcgagtggttccaaa
tcagccaccattaagcttaaagtattagataagccgggtcctccagcatctgttaaaatc
aacaaaatgtatgcagatcgtgcaatgctttcttgggaacctcctcttgaagatggaggc
tcagaaatcaccaactatattgttgacaaacgtgaaacaagcagacccaactgggcacaa
gtctcggctacagtgcccatcaccagctgcactgtggagaaactcatagagggccatgaa
tatcagttccgaatttgtgcagagaataaatatggagtgggcgatccaatcttcactgaa
ccagcaattgctaaaaacccatttgacccacccgggcgctgtgatcctcctgttattagc
aacataaccaaagatcacatgacggtaagctggaaaccaccagcagatgatggcggctca
cccatcactggctatttggttgaaaagcgagagacccaggcagttaactggactaaagtc
aacagaaaacctgttatagaaagaacaataaaagcaacaggtctccaagaaggcaccgaa
tacgagttccgagttacagctataaataaggctggaccagggaaacccagtgatgcatcc
aaagctgcttatgcccgggaccctctgtatcctcctggcccaccagcttttcctaaagta
tatgatacaacccgtagctctgtgagtctatcttggggcaagccagcctacgacggtggt
agccctatcattggctaccttgttgaagtaaaacgagctgactctgataactgggtgagg
tgcaatttaccagagaagctacagaaaacccgctttgaggttactggcctaatggaagac
acagagtatcagttccgcgtgtatgccgttaataagatcggatacagtgaccccagtgat
gtgccagacaaacatcgtcccaaggacatcttaattccacctgagggagaactcgatgct
gatttgaggaaaacactcatattacgtgctggagttacaatgagactgtatgtaccagta
aaaggacgtccacctccaaagataacttggtctaaaccaaacgtcaatctaagagaaagg
atcggacttgacataaaatcaacagattttgacactttcttgcgctgtgaaaatgtgaac
aaatatgatgcaggaaaatatatcttgactctggagaacagctgtggtaaaaaggaatat
accatcgtagtgaaagtgcttgatactcctgggccacctgtcaatgtcactgttaaggaa
atatccaaagattctgcttatattacctgggatcctcccattattgatggcggaagtccc
atcataaactatgtggtggaaaaacgtgatgcagagaggaagtcctggtctacggtgaca
actgagtgctcaaaaacaagcttcagagtgtctaacttggaggagggaaaatcctacttc
ttcagggtgtttgctgaaaatgagtatggcattggcgatcctggtgaaacacgtgatgcc
gtcaaagcttccgaaacccctggaccagttgtggacctgaaagtgttatctgtaactaag
tcatcttgtagcataggctggaaaaagcctcgcagtgatggtggcagtcgagttaccgga
tatgtagtagatttcctgactgaagacaataagtggcaacgtgttatgaaatcattaagc
ttacagtactctgcaaaagatttgactgaaggcaaggaatataccttcagagtgagtgct
gagaatgaaaatggagaaggaacccccagtgaaatcactgcagtggcaaaggatgatatt
gtggctcctgaccttgacttaaaggacatacctgatctgtgctacttggctaaagaaaat
agcaacttccgtcttaagatccccataaaaggcaagccagctccatcagtaacctggaag
aaaggggaagatcctctaccaactgacaccagagtcagtgttgagtcaactgcagttaac
actactctggtggtacatgattgccaaaaatctgatgctggaaaatacactatcacactg
aagaatgttgccggcaccaaggaaggaactctctctataaaagttgttggcaagcctggc
atccccacagggccaatcaaatttgaagaagtcacagcagaagccatgaccttaaagtgg
ggccctccaaaggatgacggaggttctgaaatcaccaactatatcctagagaagagagat
tctgtgaacaacaagtgggtgacgtgtgcctcagctgtccagaaaaccacctttagagta
accagacttcatgagggcatggaatacactttcagggtcagtgccgaaaataaatatggt
gtaggagaaggcttgaaatcagagccagttgttgctaaacatccatttgatgtgccagat
gcccccccacctcccaacatcgtggatgtcagacatgactcagtatctctaacttggact
gaccccaggagaactggtggctctccaattacagggtatcatattgagttcaaggaaaga
aacagccttttgtggaagagagctaacaagacacctattaggatgaaagacttcaaagtg
acaggattaactgaaggtcttgagtatgaattccgagtcatggcaatcaatttagcagga
gtaggcaagccaagcctgccatcagagccagttgtggcacttgatccgattgatcctcct
ggcaaacctgaagttattaatgtaacaaggaattcagtgaccctcatttggactgaaccc
aaatatgatggtggtcataagttgactggatatatagtggagatgcgggacctaccctct
aagacttggatgaaagccaaccatgttaatgtcccagattgtgcctttactgtaactgac
cttgttgaaggtggaaaatatgaattccgagttagagcgaagaatacagcaggtgctatc
agtgctccatcagaaagtacaggaaccattatctgcaaggatgaatatgaggcaccaacc
attgtcctcgatcccacaataaaagatgggctgacaattaaagcaggagataacattgtt
ttgagtgccattagcattcttggcaagccccttccaaagtcgagttggtctagagcagga
aaagacattagaccatcagatattgttcagatatcttcaaccccaacatcttccatgctt
actgtcaagtatgccactagaaaagatgctggtgaatataccattactgctaccaatcct
tttggcacaaaggaggaacatgtgaaggtaacagtcctcgacgtacctggtcctccaggt
cccattgaaatcagtaatgtttctgctgaaaaagcaacactcacatggacacctccattg
gaggatggtggctcaccaattaagtcctatgttcttgaaaagagagaaaccagtcggctc
ttgtggacagtggttgctgaagatattcagacttgcaggcatgtggccaccaaacttatc
caaggaaatgagtacctcttccgggtctcagctgtaaaccagtatgggaaaggagaacct
gtacagtctgaacctgtcaaaatggtggacagatttggtccccctggccctcctggaaaa
ccagaagtatcaaatgtcactaaaaacactgccactgtcagttggaaaagaccagttgat
gacggcggtagtgaaatcacaggatatcatattgaaaggagagaaaagaaaagcttgcga
tgggtgagagcaaccaagacgccagtttcagatctcagatgcaaagtaacaggactgcaa
gaaggaaacacctatgaattccgtgtcagtgcagaaaacaaagcaggaattggtccacct
agtgatgcctcaaatcctgttctgatgaaagatgtagcatatcccccaggcccaccttca
aatgcacgtgtcactgatactaccaaaaagtctgcttctttagcatggggcaagcctcat
tatgatggaggacttgaaatcactggctatatcgtagagcatcaaaaagtaggagaggag
gcctggataaaagatacaacaggaactggtgtccgaatcactcaatttgttgtccctgat
cttcagactaaagaaaaatacaattttagaatcagagccatcaacgatgcaggtatcggg
gagccagcaataattacagatgttgaaattgtagaacgggaaatggctcctgattttgaa
ctagatgccgagcttcgaagaacacttgttgttagagcgggactcagtattagaatattc
gtgcccattaaaggtcgtcctgctcctgaagtgacatggaccaaagatgacatcaacctt
aaaaaccgagctaacattgaaaacacggaatcatttactcttctgattataccagaatgt
aacagatatgacactggtaaatttgtcatgaccattgaaaaccctgctgggaagaaaagt
ggctttgttaatgtcagagtcctggataccccaggacccgtccttaacctgaggcctaca
gacatcacaaaggacagcgtcaccctgcactgggacctccctctgatagatgggggctcc
cgtataacaaactacattgtggagaaacgagaagcaacacggaaatcttattccacagtc
accacgaagtgccataaatgcacatataaagttactggcctgtcagaaggatgtgaatac
ttcttcagagtgatggcagaaaacgaatatggaattggtgagccagcagaaacaacagaa
cctgtgaaggcctcagaagcaccgtccccaccagacagtctgaacattatggacataact
aggagcacagtcagcctggcatggcctaaaccaaagcacgatggtggcagtaagatcact
ggctatgtgatcgaagcccaaagaaaaggctctgaccaatggacccatgtcagcaccgtg
aaggggttagaatgtgtcgtgaagaatctaaccgaaggggaagaatacaccttccaggtg
atggcagtgaacagtgcaggaagaagtgcccctagagaaagcagacccgtcattgtcaag
gagcagaccacgcttccagaactggatcttcgtggcatttatcagaaactagtcatcgcc
agagctggtgagaacatcaaagtggaaattccagtgcttggtcggccaaagcccacggtt
acgtggaaaaaaggagaccagattcttaaacagacacagagagttaattttgaaaataca
gccacttcaaccatcttaaatatcaacgagtgtgtaagaagcgatagcgggccctatcca
ttaacagcaaggaacattgtaggagaggttggtgatgtcatcaccattcaagtccacgat
atcccagggccacctactggaccaatcaaattcgatgaagtttcatctgattttgtaacc
ttctcttgggacccacctgagaacgatggaggtgtaccaataagcaactatgtagtagaa
atgcgacagacagacagtactacatgggttgaattagcaaccactgtcatacgcactacc
tataaagccactcgccttactaccggagtggagtatcaattccgggtaaaagctcaaaat
agatatggagtgggaccaggcatcacatctgcatctatagttgccaactatccatttaag
gttcctgggcctcctgggacccctcaggtgactgcagttaccaaggattcaatgacaatt
agctggcatgagcctcttactgatggtggaagccccattttaggataccacgttgaaaga
aaagaacgaaatggtattctctggcagactgtgagcaaagcattagtaccaggcaacatt
ttcaaatcaagtggacttacagatggtattgcttatgaattccgagtgattgcagaaaac
atggcagggaaaagcaagccgagcaagccatctgaacctatgcttgctttagatcccatt
gacccacctgggaaaccaattcctctaaatattactagacacacagtgacacttaaatgg
gctaagcctgaatacactggaggctttaaaattaccagttatatagttgaaaagagagac
cttcccaatgggcggtggctgaaggccaactttagcaacattctggagaatgaatttacg
gtcagcggcctaacagaagatgctgcctacgaattccgtgtgattgccaaaaatgctgct
ggtgctattagtccaccatctgagccatcagatgctatcacgtgcagggatgacgttgaa
gcaccaaggataatggtggatgtgaaatttaaagacacagtaatactaaaagcaggtgaa
gcattcaagctagaagctgatgtttcaggtcgcccaccaccaacaatggaatggaccaaa
gatggaaaggagcttgaaggcacagcaaagttagaaataagaattgcagatttctctact
tacctgataaacaaggattcatcaagaagggacagtggtgcctatatccttacagcaacg
aatcctggtgggtttgctaaacacattttcaatgtcaaagttcttgatagaccaggccca
cctgaaggacctttagctgtatctgaagtgacatcagaaaaatgtgtgttgtcatggttg
cctccactggatgatggaggtgccaaaattgattactatatagttcagaaacgtgaaacc
agcagattggcatggacaaatgtagcctcagaagtccaagtgacaaaactgaaggtcact
aaacttctgaaaggcaatgaatacatattccgcgtcatggctgtaaataaatatggagtt
ggagagccactggaatcagagcctgtgcttgcagtaaatccttatggaccccccgatcca
cccaaaaaccctgaagttacagctattactaaagattcgatggttgtctgctggggacat
cctgactctgatggtggaagtgaaatcatcaattatattgtagaacggcgtgataaagct
gggcaacgctgggtgaaatgcaacaagaaaactcttactgatctaagatataaagtgtct
ggactgacagaaggacatgaatatgagttcaggattatggctgaaaatgctgctggaatt
agtgcaccaagttctaccagtccattttataaagcttgtgatgctgtgtttaagcccggc
ccaccaggtaacccacgtgttctagattcgagcagatcatccatttcaattgcttggaat
aagcctatctacgatggcggttcagaaatcactgggtatattgttgagattgccctgcca
gaggaggatgaatggaagattgtcactccaccagctggactcaaggcaacctcttacacc
atcaccaacctcgtagagaatcaggaatataaaatccgcatctatgccatgaattctgaa
ggaatgggagaacctgcacttgttcctggaactccaaaggctgaagagaggatgctgcct
cccgagattgaactggatgctgacctgcgtaaagttgttactataagagcttgctgtacc
ctgagactttttgttccaatcaaaggaaggcctgcacctgaggtgaagtggacccgggaa
catggagaatccttagataaagctagcattgaatccacaagctcttacaccttgcttatt
gttggaaatgtaaacagattcgacagtggcaaatacatactaactattgaaaacagctca
ggtagcaagtctgcgtttgtcaatgttagagtactagacacaccaggccctccacaggat
ctcaaggtaaaggaggtcactaagtcatctgtcacattgacatgggagcctcctctcctt
gacggaggctcaaaaataaagaactatattgttgaaaagagggaatcaacaagaaaagca
tattcaactgttgcaacaaactgccataagacgtcctggaaggtagaccagcttcaagaa
gggtgtagttactacttcagggttctcgctgaaaatgaatatggcattgggttgcccgct
gaaactgcagagtctgtgaaagcatcagaacgaccccttcctccaggaaaaataactttg
gtggatgtcaccagaaatagtgtgtcactgtcttgggaaaaaccagaacatgatggaggc
agccgaattctaggctacattgttgagatgcagagcaaaggtagtgacaaatgggccaca
tgtgccacagtcaaagtcactgaagccactataaccggattaattcagggtgaagaatac
tctttccgtgtttcggctcagaatgaaaagggcatcagtgatcctagacaactgagtgtt
ccagtaattgccaaagatcttgtcattccaccagccttcaaactcctgttcaatactttc
actgtactggcaggtgaagacctaaaagttgatgttccattcattggacgccctacacct
gctgtaacctggcataaagatgacgtaccactgaagcagacaactagagtaaatgcagag
agcacagaaaataattcactattgacaataaaggaagcctgccgagaagatgttggacat
tacacagttaaactgactaactcggctggtgaagctactgaaacccttaacattattgtt
cttgacaaaccagggcctccaactggaccagttaaaatggaggaagtgacagctgatagt
attactctttcctggggcccacctaagtatgatggtgggagttctatcaataattacatt
gtagaaaaacgggacacttccacaaccacctggcaaattgtgtcagcgactgttgcaagg
acaacaataaaggcttgcagattaaagactggatgtgagtatcagtttaggattgcagct
gaaaacagatatggaaagagcacttacctcaattcggagcctatcatagcccagtatcca
ttcaaagttcctggtcctcctggcacaccatttgtaatgctctcctccaaggacagcatg
gaggtacactggaatgagccagttagtgatgggggtagcaaagtcattggctatcatctg
gaacgcaaggaaagaaacagtatcctctgggtgaagttgaataaaacacccattcctcaa
accaagtttaaaacgactggcctcgatgaaggcattgaatatgaatttagagtctctgca
gagaacatcgtgggcatcggcaagccaagtaaggtgtcagaatgctatatggctcgtgac
ccatgtgatccaccagggcggccagaagcaattattgtcacacgaaattctgtgactctc
cagtggaagaaacctacttatgatggtggaagcaagatcaccggctatattgtagagaag
aaagaattgcctgaggggcgctggatgaaagccagttttacaaatgtcattgacactcag
tttgaagtaactggcctagttgaagatcacagatatgagttccgggtaatagctcgaaat
gctgcaggagtgtttagtgagccttcagaaagcacaggagcaataacagcaagagacgag
gtagagccaccacgaataagtatggatccaaaatacaaagacacaattgtagttcatgct
ggtgagtcgttcaagattgatgcagatgttcatggcaaaccaataccgaccattcagtgg
gtaaaaggtgatcaggagctttcaaatacagctcgattagaaataaagagcactgacttt
gccacgagtctcagtgtaaaggaagcaatacgcaatgacagtggaaattacatactgaag
gccaaaaatgttgcaggggagaggtcagttactgtaaatgtcaaagttcttgatagacca
ggaccacctgagggacctgttctagtatcaggagtgacagcagaaaaatgcacactagct
tggaaacccccactacaggatggtgggagtgacatcataaattatattgtggagaggaga
gaaaccagccgcttagtttggactctggttgatgccaacgtgcaaactctcagctgcaag
gttactaagcttctcgaaggcaatgaatatattttccgtataatggctgtaaacaaatat
ggtgttggtgaaccactagaatctgagccagtgattgccaagaatccatttgtagtgcca
gatgcaccaaaggccccagaaatcacaacagtgaccaaggactcaatgatcgttgtatgg
gaaagaccagaatctgatggtggcagtgaaattcttggatatgttcttgaaaaacgcgat
aaggagggcgttagatggacaagatgtcacaaacgcctgattggggaattgcgcttgaga
gtaactggactcctagaaaatcacaattatgaattcagagtctcagccgagaatgctgct
ggacttagtgaaccaagcctgccttctggttaccaaaaggcttgtgatcctatttataaa
ccaggacctccaaacaatcccaaagtcatagatattaccagatcttctgtcttcctttct
tggagcaaaccaatatatgatggtggctgtgaaattcaaggctacattgttgaaaaatgt
gacgtgagtgttggtgaatggaccatgtgcactccaccaactggaatcaataaaacaaat
atagaagtagaaaagctgttggaaaagcatgaatacaatttccgtatctgtgctgttaat
aaagctggagttggagaacatgctgatgtccctggacctgttatagttgaagaaaaatta
gaagcaccggacattgaacttgacctagaactaagaaaaattataaatataagggcaggt
ggctccttaaggctctttgtccctattaaaggtcgtcctacaccagaagttaaatggggg
aagatggatggtgaaatccgagatgcagctataattgatgtcactagcagtttcacctct
cttgttcttgacaatgtcaaccgctacgatagtggaaaatatacactcacattagaaaac
agcagtggaacgaagtctgcctttgttactgtgagagtcctggacacaccaagtccgcct
gttaacctgaaagtcacagaaatcacaaaagactcagtatcaattacatgggaacctcct
ctgttggatgggggatccaaaataaaaaattacattgttgagaaacgtgaagccacaaga
aaatcatatgctgcagtggtaacaaactgccataagaattcttggaagattgagcaactc
caagaaggctgcagttattactttagagtcacagctgagaacgagtacggtattggcctt
cccgcccacactgctgatcctattaaggttgcagaagtcccacaacctccaggaaaaata
actgtggatgatgttaccagaaacagtgtctccttgagttggacaaagcctgaacatgat
ggtggcagtaaaatcattcagtatattgtggaaatgcaagctaaacacagcgagaaatgg
tcagaatgtgctcgagtcaagtcccttgaagcagtaattactaacctaactcagggagaa
gagtatctctttagagttgttgctgtgaatgaaaagggaagaagtgatcctaggtccctt
gcagttccaatagttgccaaagatctggtcattgagccagatgtaagacctgcattcaac
aattacagtgtacaggtcggccaagatttgaaaatagaggtgccaatttctggacgtcct
aagccaaccgttacctggactaaagatggtcttccactgaagcagaccacaagagtcaat
gttactgattcacttgacctcactgtactcagcattaaagaaactcataaggatgatggt
ggacattatggaatcacagtgactaatgttgtaggtcagaaaacagcatccattgaaatt
ataactctagataaacctgatcctccaaaaggacctgttaaatttgatgaagtcagtgct
gaaagtattactttatcttggaatcccccattatatacagggggctgccagatcaccaac
tacattgttcagaaaagagatacaaccaccacagtatgggatactgtttctgctactgtt
gccagaaccacgctcaaagtgaccaaactgaaaactggtacagaataccaattcagaata
tttgctgaaaacagatacggacaaagctttgccttggagtctgatccaattgtagctcaa
tatccctacaaagaaccaggccctccaggcacaccatttgtcacagccatttccaaagac
tccatggtcgttcagtggcatgaaccaatcaataacggtggaagcccagtcataggttac
caccttgagagaaaggaaagaaatagtattttgtggacaaaagtcaacaaaactattatt
catgacactcagtttaaagcagtcaatcttgaagagggcattgaatatgaattcagagtt
tatgctgaaaatattgttggtgtaggtaaagcaagcaagaattccgaatgctacgtagcc
agagatccttgtgacccaccaggaaccccagaagcaataatggttaaaagaaatgaaatc
actttacagtggaccaaacctgcttatgatggtggaagtgtgattacaggttacattgta
gagaaacgtgatttgcctgagggtcgctggatgaaggccagcttcacaaatgtcattgaa
actcaatttactgtgtccggtcttactgaagatcaaagatatgagttcagagtcattgca
aagaatgcagctggtacaataagtaaaccctctgacagtactggaccaataactgccagg
gatgaggttgaacttccaagaatttcaatggatccaaaattcagagacacaattgtggta
aatgctggagaaacgttcaggcttgaggctgatgtccatggaaagcccctaccgaccatt
gagtggttacgaggagataaggaaattgaagaatctgccagatgtgaaataaaaaacaca
gatttcaaggctttacttattgtaaaagatgccattagaattgatggtggacagtatatt
ttaagagcttccaatgttgcaggttctaagtcattcccagtaaatgtaaaagtattggac
agaccaggacctccagaaggtccagtccaggttaccggagtcacttctgaaaaatgcact
ttaacatggtctccaccacttcaagatggtggcagtgatatttctcactatgtcgttgaa
aagagagaaacaagtcgacttgcctggactgttgttgcttcagaagttgtgaccaattct
ctgaaagttactaaactcttagaagggaatgaatatgttttccgcataatggctgtcaac
aagtatggagttggagagcctttggaatctgcaccagtactaatgaaaaatccatttgtg
cttcctggaccaccaaaaagcctggaagtcaccaacattgccaaggactccatgactgtc
tgttggaaccgtccagatagtgatggtggaagtgagattatcggttacattgtggagaaa
agagatagaagtggcattaggtggataaaatgtaataaacgccgcattacagatttgcgt
ctaagagtaacaggattaacagaagatcatgagtatgaattcagagtctctgcagaaaat
gctgctggggttggagaaccaagtccagctacagtttattataaagcttgtgatcctgta
ttcaaacctggaccacccaccaatgcacacattgtagacaccactaaaaattcaatcaca
cttgcctggggtaagcccatctatgatggtggcagtgagatccttggatatgtagtagaa
atctgtaaagcagatgaagaagaatggcaaatagttactccacagactggcctgagagcc
actcgatttgaaattgcaaaactcactgagcaccaagagtataaaatacgagtctctgcc
ctcaataaagttggcttaggtgaggctacatcagttcctggtactgtgaaaccagaagat
aaacttgaagcacctgaacttgatcttgactctgaattaaggaaaggaatagttgtaaga
gctggtggatctgccagaattcacattccattcaaaggtcgcccaacacctgagatcacc
tggtctcgagaggaaggtgaattcacagataaggtccaaattgaaaagggggtaaactat
acccaactatcaatagataactgtgatagaaatgacgctggaaaatacattctcaagctg
gaaaacagcagcgggtctaaatctgctttcgtaactgtgaaagttcttgacaccccagga
ccaccacaaaatttggcagtcaaagaagtgaaaaaagattctgtcctgctggtatgggaa
ccacccatcattgatgggggttcaaaggtgaagaactatgttattgacaaacgtgagtca
accagaaaagcatatgctaacgtgagtagcaaatgcagcaaaaccagctttaaagttgag
aatcttacagaaggagccatttattactttagagttatggcggaaaatgaatttggagtt
ggtgttccagtggaaactgctgatgctgtgaaagccgctgaacctccttccccaccagga
aaagtgacactcactgatgtgtcccagaccagtgcatcgctgatgtgggagaaacctgaa
catgacggtggcagcagagtcttgggttatgttgttgaaatgcagcccaaaggaacagaa
aaatggagtgttgtggccgaatccaaagtctgcaatgcagtggttactggtttgagttct
ggacaagaatatcagttccgtgtcaaggcttacaatgagaaaggaaaaagcgatccaaga
gtgcttggtgttcctgtcatagccaaggacttgaccatacagcctagttttaagttacca
tttaacacatatactgtccaagctggagaagatcttaaaattgaaattccagtaattggc
cgaccaagacctaacatttcatgggtcaaagatggtgagcctcttaaacagacaacaaga
gtaaatgtcgatgaaacagctacttcaacgattctgcacattaaagaaagtaacaaagat
gactttggaaaatacactataacagcaacaaatagtgcaggtacggcaacagaaaatctc
accatcattgttttggaaaagcctggacctccaattggaccagttcggtttgacgaagtt
agtgcagactttgtggtcatctcttgggaacctcctgcctatactggcggctgccagata
agcaactacattgtagagaagcgagatacaactaccaccacttggcacatggtctcagca
acagttgcgagaacaacaattaaagtaaccaaactgaaaacaggcactgagtaccagttt
agaatttttgcagaaaacaggtatggaaagagtgcccctctggattccaaaccagttatt
gtacaatatccatttaaagaacctggaccacctggaactccttttgtgacatccatttca
aaagatcagatgattgtgcagtggcatgagccagttcatgatggaggaagcaaaattatt
ggctaccatcttgaacagaaagaaaagaacagcattttatgggtcaaattgaataagact
cccattcaagacacgaaattcaaaacaactgggctcgatgaaggccttgagtatgagttc
aaagtttctgctgaaaatattgttggcattggcaagcctagcaaagtatcagaatgcttt
gttgctcgtgatccatgtgacccacctggtcgccctgaagccattgtcatcacaagaaac
aatgttacactgaaatggaagaaacctgcctacgatggtggtagcaagataacaggttat
attgtagaaaagaaagatctacctgatggacgctggatgaaagccagctttaccaatgta
ttagaaactgaatttacagtgagtggacttgtggaagaccaaagatatgaatttagagta
attgcaagaaatgcagctggcaacttaagtgaaccatctgaaagcactggtgccattact
gccagagatgaaattgatgcaccaaacgcctccctggatccaaaatataaagacgtaatc
gttgttcgtgcaggagagacttttgtccttgaagctgatatccgcggcaagcctatacct
gatattgtttggtcaaaagatggaaaagagcttgaagagacgactgctaggatggaaatt
aaatctactattcagaaaaccactcttgttgtcaaagactgtatacgtactgatggagga
cagtatattctgaaactcagcaacgttggcggtacaaagtccataccaatcactgtaaag
gtacttgacaggccagggccccctgaaggacctctgaaagtttctggagttactgctgag
aaatgttacctggcatggaacccacctttacaggacggtggtgctaatatttcacattac
atcattgaaaagagagaaacaagtagactctcctggacccaggtttcaactgaggtacag
gcccttaactacaaagtcactaaacttcttcctggtaatgagtacattttccgtgtcatg
gctgtgaataaatatggaattggagagcccctggaatctgagcctgttatagcctgtaat
ccgtataagccaccaggtcctccttcaccccctgaagcctcagcaatcaccaaagattct
atggtagtaacatgggcacgcccagtggatgatggaggtgccgaaattgagggctacatt
cttgaaaaacgagataaggaaggcattagatggaccaagtgcaacaagaaaactctaaca
gatctccgattcagagtaactggccttaccgaaggtcattcctatgagttcagagtcgct
gctgaaaatgcagctggtgtgggtgaacccagcgagccatctgttttctatcgtgcatgt
gataccttatatccaccaggtccaccaagtaatccaaaagtgacagacacttccagatct
tctgtctccctggcatggagtaagccaatttatgatggtggtgcacctgttaagggctat
atggtggaggtcaaagaaggcgctgctgatgaatggacaacctgcactccaccgacagga
ttacaaggaaagcagttcacagtgaccaagctaaaagaaaatactgagtataacttccgt
atttgtgccatcaattctgaaggtgtaggtgaacctgcaactatacctggctcagttgtt
gctaaagagaggctagagccgccagaaatagaacttgatgctgatctcagaaaggtggtc
attctgcgggcaagtgctactttacgcttatttgtcacaatcaaaggtcgaccagaacct
gaagttaaatgggaaaaggccgaaggcactctcacagagagggcccagatcgaggtgacc
agctcctacacaatgttggtaattgataacgttaccagatttgatagcggtcggtataat
ctgacactagaaaataacagcggctccaaaacagcttttgttaacgtcagagttcttgac
tcgccaagcgcccctgtgaatttaaatgtaagagaaataaagaaagattcggtgacattg
tcttgggagccaccacttattgatggcggagctaagattacaaactacattgttgaaaaa
cgagaaactacaagaaaagcatacgctactgttacaaacaattgcacgaagaatactttt
aaaattgaaaatctacaggagggatgttcttactacttccgagtcttggcttccaatgaa
tacgggattggtttgccagctgaaacgactgaacccgttaaagcttctgaaccacccctc
ccacccggaagagtgactcttgttgatgtgacccgtaacacagctacaatcaagtgggag
aagccagaaagtgatggtggcagcaaaattactggttatgtagttgaaatgcagactaaa
gggagtgaaaaatggagcacttgcacacaagttaagactctagaagcgactatatctggc
ctaactgcgggagaagagtataccttcagggtagctgcagtcaatgaaaagggaaggagt
gatccgagacaacttggagtgccagtagttgcaagggatattgaaataaagccctccgtc
gagcttcctttcaatactttcaatgtaaaggctagggaccaacttaagattgatgttcca
tttaaaggaagacctcaagctactgtaagctggaaaaaggatggtcagattcttaaagaa
accacaagggtcaatgtttcttcttcaaagactgtaacatcactatctattaaggaagct
tccagggaagatgttggaacttacgaattatgtgtttcgaacagtgctggatccataaca
gttcctataactgtaattgtccttgacaaaccagggcctccaggacctgttcttattgat
gaagttagctgtgacaatgtaacaatttcctggagtcctccagaatatgacggtggctgc
caaattagcaattacatcgtcgaaaagagagaaaccacttctaccacatggcatgtagtt
tcacaggcagttgcgagaacatccattaaaatagttcgtctgacaacaggaagtgagtat
cagttccgtgtttgtgcagaaaaccgctatggcaagagctcctacagtgaatctaaacct
gttgttgcagagtatccattcagccctccaggtcctcccggcactcctaaagttgtgcat
gccacaaaatctaccatgattgtaagctggcaagtgccagttaatgatggaggaagtcga
gtaattggctatcaccttgaatataaagagagaagcagcattctttggtcaaaagcaaat
aaaatcctcatcgctgatacacaaatgaaagtctccggccttgatgaaggactgatgtat
gagtatcgtgtatatgctgagaacattgctggaattggtaaatgcagtaaatcttgtgaa
ccagtccctgcaagagatccctgtgatcctcctggacaacctgaagtcacaaatatcaca
agaaaatcagtgtcgcttaaatggtctaaaccacattacgacggtggagctaagatcaca
ggatacattatcgaacgtagagaactaccagatggccgatggctgaagtgcaattttact
aacgtacaagaaacatactttgaagtaactgaacttactgaagatcagcgttatgaattc
cgggtttttgcaaagaatgcagctgactcagttagtgaaccatctgaatccactgggcct
attacagttaaagacgatgttgaggctccaagaattatgatggatgtcaagttccgagat
gttattgttgtcaaagctggagaggtccttaagataaatgcagacatcgcagggcgacct
ctgccggtaatttcctgggccaaggatggggtagaaattgaagaaagagcaagaacagaa
attgtctcgacagactataatacttcgttaacagtgaaagactgtatccgacgagacact
ggccagtatgtactaacactaaagaatgttgcaggaactcggtctatggcagttaactgc
aaggtacttgataagcctggcccaccagcaggaccacttgaaataaatggcctcacagct
gagaaatgctcacttttctggggaccgccccaagaaaatggtggtgcagatatcgactat
tacattgtagaaaaacgtgaaacaagccacctcgcatggacaatatgtgaaggagaatta
aggacaacatcctgtaaagtaaccaagttactcaaaggcaacgaatacatctttagagta
acaggtgttaataaatacggtgttggtgagcccctagagagcatggcagtaaaggcacta
gacccatttacagttccaagtccacccacatctctggaaattacatctgtgaccaaagag
tccatgaccctttgctggtcaagaccggagagtgatggaggcagtgaaatctctggatat
ataattgaaaggcgagagaaaaacagcctacgatgggtgcgtgtaaacaaaaaaccagtt
tatgacctgagagtgaaatcaaccggacttcgggaaggatgtgaatatgagtaccgagtt
tatgcagaaaatgctgctggcctgagccttccaagtgaaacctctcccttaattcgggca
gaagatccagtattcttgccatctcctccatccaaacccaaaattgtggactcaggcaag
acaaatataactattagctgggttaagcccttgtttgatggcggggccccagtaactgga
tacactgtagaatataagaaatctgatgaaactgagtgggagactgccattcagaactta
agaggcacagaatataccacaggcggactaacaacaggagccgagtatgtgtttagagta
agatctatcaataaggttggtgctagtgatcccagtgatagctccgatccccaagtagca
aaagaaagagaagaagaacctgtatttgatcttgacagtgaaatgaagaagaccttgatt
gtcaaggccggtgcctcatttaccatgaccgtacctttccggggaagaccagcacctagt
gtcttgtggagtaagccagacagtgacctccgcactagagcttatattgattccacagac
tctcgtacgtcacttactattgaaaatgccaacagaaatgattccggaaaatacacagta
acaattcagaatactgtgaatgctgcttcactgaccttagttgtcaaagttttagattct
cctggtcctccaaccaatatcactgtacatgacataaccaaagagtctgcagtgttatcc
tgggatgttcctgaaaacgatggtggagcaccagtgaagaattaccacatagaaaaacgt
gaggccagtaagaaagcatgggtctctgtgaccaacaactgtaaccgcctctcctacaaa
atcaccaacttacaagaaggggcaatttactacttccgagtctctggagagaatgagttt
ggtgttggtgtaccagctgaaacaaaggaaggcgtaaaaataacagaaaaaccaagccca
cccgaaaaacttggagtaacaggtgtatccagagatagtgtttccctgacctggttgaag
ccagaacacgatggtggaagcagaattgtacattatgtcgttgaagcattagaaaagggg
cagaaaaattgggttagatgtgcagtggtaaagtcaacccaccacattgtttctggtctg
agggagaattctgaatactttttccgggtgtttgctgaaaatcaagctggtctcagcgac
ccaagagagctcctgcttcctgttcttattaaagaacaactagaaccacctgaaattgat
atgaagaatttcccaagtcatactgtgtatgtgagagctggttcaaaccttaaagttgac
attccaatttctggaaaaccactgcccaaagtgaccttatcaagagacggtgtccccctg
aaggcaaccatgagatttaatactgaagttactgctgagaacctgaccatcaatctcaaa
gaaagcgttaccactgatgctggaagatacgagatcactgctgccaactccagtggaaca
accaaagctttcattaacatcattgtactggacaggcctggtcccccaactggccctgtt
gttattagcgatataacagaagaaagtgtgactctcaaatgggagccgccgaagtatgat
ggcggaagtcaagttactaactacattgtactcaagagagagacgagtactgcagtgtgg
actgaagtatctacaacagttgcaagaaccacgattaaaatcatgaaactgaccacagga
gaagaataccagttccgcatcaaggcagaaaaccgctttggcatcagtgatcacatagat
tcagcgtgtgtggttgtcaaactaccatacacaacacctggaccaccatctacaccatgg
gtcactaatgttactcgagaaagcatcaccgtgggctggcatgaaccagtgtccaatgga
ggcagtccagttataggctatcacctggaaatgaaagacagaaacagtgttttgtggcaa
aaagccaacaaattggtcatccgtacaactcacttcaaagtcaccacaatcagtgctgga
cttatttatgaattcagggtatacgcagaaaatgctgctggtattggaaaaccgagccat
ccttctgaaccagtcctagccattgatgcctgtgagcctccaagaaatgtccgtatcact
gatatttcaaagaactctgtcagcctctcatggcaacaaccagctttcgatggaggaagc
aagattacaggctacattgttgagagacgagaccttccggatggcagatggaccaaggcc
agcttcaccaatgttattgagactcaattcatcgtctctggcttgactcagaattcccag
tatgaattccgtgtctttgctaggaatgccgttggttcagtcagcaatccatccgaggtt
gtaggccccattacatgcattgattcttatggtggacccgtaattgatttgcctctagaa
tatacagaagttgtcaaatacagagcaggcacatctgtgaagctcagagctggcatttct
ggcaaacccgagcctacgattgagtggtataaagatgataaagagttacaaaccaacgca
ctggtatgtgtcgaaaataccaccgaccttgcgtctatactcatcaaagatgcaagtcgc
cttaatagtggaagctatgaactaaaactaaggaatgccatgggttcagcctcagccacc
atcagagtacagatcctggacaaaccaggacctccaggtggtcccattgaatttaagacg
gtcactgctgaaaaaataacccttctctggcgccctcccgcggatgatggtggtgcaaaa
atcactcactacatcgtggaaaaacgtgagacaagccgtgttgtatggtctattgtgtct
gaaaatttggaagaatgcatcataaccaccaccaaaattatcaaaggaaatgaatacatc
ttccgggttcgagccgtgaacaaatacggaattggtgatccgctggaatccgatccagtg
gtagcaaagaatgcctttgttactcctgggcctccaggcgtaccggaggtgaccaagatt
accaagaattcaatgactgttgtctggagcaggccagttgtcgatggtggtagtgaagta
agcggctatttccttgagaaaagagacaagaagagtctaggatggtttaaggtctcaaag
aagactatccgtgacaccagagagaaagtgactggactaacagaaaacagtgactaccaa
taccgagtctgcgctgtaaatgctgctggtcagggtccattctctgagccatctgacttc
tacaaagctgctgatcccattgaccctccaggcccaccagctaagataagaatcgcagat
tcaaccaaatcctccatcactcttggctggagtaaacccgtctatgacggaggcagtgct
gttactggatatgttgtcgccatgaggcaaggagaggaagaggaatggactgttgtctct
accaagggagaggtcagaactacagaatatgtggtatccaacctgacacccggaatcaac
tactacttccgggtatctgctgtaaactgtgccggacaaggagaacctatagaaatgact
gaagctgtacaagctaaagatatacttgaggaaccagagatcgacctagatgtggctctc
agaacctctgttatagctaaagctggtgaagatgtacaagtgttgattcccttcaaaggc
agacctccacctactgtcatatggagaaaagatgagaagaatctcagcagtgatgccaga
tataacattcaaaacaccgattcatcttcattactcacaattcctcaagtcactcgcaat
gacacaggaaaatatattctcacaatagaaaatggcgttggtcaaccaaagtcttcaact
gtgagtgttaaagtgcttgatacgccagccgcctgccagaaactacaggtgaaacatgtt
tctcaaggcacagtcactttgttctgggatcctcctctcattgatggaggatctcccata
attaattatgtcattgaaaagagagatgccaccaagagaacatggtcttcagtatcacac
aaatgtaccagtacatcctttaagataacagatttgtcagagaaaactccattcttcttc
agagttcttgcagaaaatgagattggaattggggaaccctgtgaaactacagagccagtg
aaggctgctgaagtcccagctcccatacgtgatctgtcagtgaaagactcaacaaaaaca
tctgttaccctgagctggaccaagcctgattttgatggtggtagcgtcatcacagaatac
gttgtggaaaggaaaggtaaaggtgaacaaacatggtcacgtgctggtgtaagtaagacc
tgtgaaattgaagttagccaacttaaggaacagtcagtcctggaattcagagtgtttgcc
aaaaatgacaaaggactgagtgatgctgtcactattgggccaattacagtgaaagaactt
gtgattacacctgaagttgacctgtcagatatccctggggcacaagtcgctgtgagaatt
gggcataatgtgcacctcgaattaccttataaaggaaaacccaaaccatctatcagttgg
ctgaaagatggtttgccattgaaagaaaccgagtatgttcgtttcagtaaaaccgaaaac
aaaattactttgagtattaagaatgtcaagaaggagaacggagggaaatacacccttatt
cttgataatgcagtctgcagaaactcatatcccattacaatcatcacacttggcccaccg
tcaaagcccaaagggcccattcgatttgatgaaatcaaggctgacagtgtcatcatgtca
tgggacgcgcccgaagatgatggaggaggagaaattacgtgttacagcattgagaagcgg
gaagcttcacaagctaattggaagatggtgtgttcaagtgttgccaggacaactttcaaa
gttcctaatctagtcaaagatgctgagtaccagtttagggttagggcggaaaacagatac
ggagtcagccagccacttgtctcaaacattattgtggcaaaacaccagttcaggattcct
ggccccccaggaaagccagttgtatacaatgtgacttccgatggcatgtcactaacttgg
gatgctccagtttatgacggtggttcagaagttactggattccatgttgaaaagaaagaa
agaaatagcatcctctggcaaagagttaacacatcgccaatatctggtagagaataccga
gctaccggactaatggaaggcctagattaccagttccgtgtatatgctgaaaattctgct
ggcctaagcgcgcccagtgacccaagcaaatttactttagctgtttctccagtagaccca
cctggcactcctgactacattgatgtcacccgggaaaccatcacacttaaatggaaccca
ccactgcgtgatggaggcagtaagatcgtggcctacagcattgagaaacggcaagggagc
gatcgttgggtcagatgcaactttaccgatgtcagtgaatgtcagtacacagtcacggga
cttagtcccggggaccgatatgagttcagaataattgcaagaaatgccgtcggtactata
agtccaccctcacagtcttctggcgttatcatgacaagagacgaaaacgttccaccaact
gttgagtttggccctgagtactttgatggtctcattattaagtctggagagagccttaga
attaaagctttggtgcagggacggccagtacctcgagtaacttggttcagagatggagta
gaaattgaaaagaagatgaatatggaaataactgatgtcctaggatccaccagccttttc
gttagagatgctacccgggaccatcgtggtgtatatagcgtggaagccaaaaatgcatct
ggctccgcaaaagcagaaatcacagtgaaagtacaagatacaccaggaaaagtagttggg
ccaataagattcaccaatattactggcgagaagatgaccctgtggtgggatgctcctctc
aatgacggctgtgctcccgtcactcactacatcgttgaaaaacgggaaaccagcagactt
gcttgggcactgattgaggataactgccaagcccacagctatactgccactaaactaata
aatggcaatgaataccagttccgtgtttctgcagttaacaagtttggtgtcgggaggcca
cttgactctgacccagtggttgctcaaatacaatacactgttcccgatgcccctggcact
ccagaacctagcaatgtaacaggcaatagcattaccctgacatgggcaaggccagagtca
gatggtggcaatgaaattcaacaatatatccttgaaaggagagaaaagaaaagcacacga
tgggtaaaagtgatcagcaaacgaccaatctctgagacaagattcaaagtcactggtctg
atagaggggaatgagtatgaattccacgtcatggctgaaaatgctgcaggaataggacct
gcaagtggtatctcaagactaatcaaatgtagagagccagttagcccaccaagtgctccc
actgtggtcaaagtgacagacacatccaagacaactgtgagcttagaatggtctaagcca
gtgtttgatggcggcatggaaataattggctatattattgaaatgtgcaaagctgactta
ggagactggcacaaggtaaatgcagaagcatgtgtgaaaacaagatatacagtcactgat
ctacaagcaggtgaagaatacaaattccgggttagtgctatcaatggtgctggaaaagga
gagagcagtgaagtgactggcgccattaaagcagttgaccgattagcagctcctgagtta
gatatcgatgcaaacttcaagcagacccatgttgttagagctggggccagtattcgcctc
ttcattgcctaccagggtagacctactcctacggctgtgtggaccaaacctgactccaac
ctcagcattcgggctgatatccacacaacagactccttcagcaccctcactgtggaaaac
tgcaacagaaatgatgcagggaaatacacccttaccgtagaaaacaacagtggcagtaag
tcaatcacattcactgtaaaggtgctagacactccaggcccacctggcccaatcactttc
aaggatgtgacccgtggatctgttacactgatgtgggacgctcctatccttgatggtggt
gcccgaatccatcattatgtggtagaaaaacgagaagcaagtcgtcgtagctggcaggct
atcagtgaaaaatgcactcgtcagatcctcaaggtcagtgacctggcagaaggtgttcca
tactatttccgtgtttctgcagaaaatgagtacggtgtgggtgaaccctatgaaatgcca
gaaccaatcgtagccacagaacagcctgctccacctaagagacttgatatcattgacaca
agcaactcctctgcagtcttagcttggcttaaacctgaccatgatggaggcagccggatc
actggctaccttctcgaaatgagacaaaaaggatctgacttctgggttgaggctggtcgc
accaaacagatgactttcacagtggagcgcctggttgagaacactgaatatgaattccgt
gtgaaggccaagaatgatgctggctatagtgaacccagggaagccttttcttccgtcatc
atcaaggaacctcaaattgagcccactgctgatctcactggaattactaatcagctcata
acttgcaaagcaggtagcacatttaccattgatgtcccaatcactggtcgtcccgctccc
aaagtaacatggaagcttgaagaaatgagacttaaggatacagatcgagtgagtatcata
acaacaaaagacagaaccaccctgtctgtaaaggatagcatgagaggtgactctggaaga
tacttcttgaccctggaaaacacagctggtgttaaaacatttaccatcaccgttgtggtc
attggaaggccaggtcctgtaactggccccattgaggtctcatctgtctcagctgaatca
tgtgtcctgtcatgggctgaacctaaagatgatggaggcactgacattactaattacata
gttgaaaagcgtgaatcgggtacaacagcttggcagcttgtcaattccagtgtcaagcgc
actcagattaaagtcactcatctcacaaaatacatggaatattctttccgtgtcagttcg
gagaacagatttggtgtcagcaagcctctagaatcagcaccaataattgctgagcatcca
ttcgtcccaccaagtgctcctaccagacctgaagtctaccatgtgtctgccaatgccatg
tctattcgttgggaagaaccttaccatgatggtggcagtaaaatcattggctactgggtt
gagaagaaagaacggaataccattctttgggtgaaagaaaacaaagtgccatgcttagag
tgcaactacaaagtgagtggtttggtggaaggactagaataccagttcagaacatatgca
ctcaatgccgcaggtgttagcaaagccagtgaagcttcaagacctatgatggctcaaaac
ccagttgatccaccaggaagaccagaggtgacagatgtcacaagatcaacagtgtcactg
atttggtctgccccagtgtatgatggtggcagcaaggttgtgggctatatcgtagagcgt
aagccggtcagtgaggttggagatggtcgctggctaaagtgcaactataccattgtatcc
gacaatttcttcactgtgactgctctcagtgaaggagacacttatgaattccgtgtgttg
gctaagaatgcagcgggagtaattagcaaaggatcagaatctacaggccctgtcacttgc
agagatgaatacgctccacccaaagctgaactggatgccagattacagggtgatctggtt
accatcagagcaggctcggatcttgtccttgatgctgcagttggtggcaaacctgaaccc
aaaattatctggaccaaaggggacaaggaactagatctctgtgaaaaagtctctttgcag
tatacaggcaaacgagcaactgctgtgatcaagttctgtgacagaagtgacagcggaaaa
tacacgttaacagtgaagaatgccagtgggaccaaggccgtgtctgtcatggtcaaagtt
cttgattcccctggcccatgtggaaacctcaccgtcagcagagtaacagaggaaaagtgc
actttagcctggagccttcctcaggaagatggaggagcagaaataactcactacattgtg
gaaagacgagagactagcaggctcaactgggtgatcgttgaaggcgaatgcccaaccctg
tcccatgtagttaccagactcatcaagaacaatgaatacatattccgagtgcgggcagtg
aacaaatatggccctggtgtgcctgttgaatcagagccaattgtagccagaaactctttc
actattccatcacaaccgggcatacctgaagaagttggggccggcaaagagcatatcatc
attcagtggacaaaacctgaatctgatggtggcaatgagatcaacaactacctagtagac
aaacgtgagaaaaagagcttgcgctggacacgtgtcaacaaagactatgtggtatatgat
acaaggctgaaggtgactggcctcatggaaggttgtgattaccagttccgagtgaccgcg
gtgaatgctgctggtaacagtgaacccagcgaagcttccaactttatctcatgcagagaa
ccatcatatacccctggaccaccttctgctccaagagttgtggataccaccaagttcagc
attagtttggcatggaccaagcccatgtatgatggtggcattgacatcctaggatatgtt
cttgaaatgcaagagaaggatactgatcactggtaccgagtgcacaccaatgccacaata
agaaataatgaattcactgtgccagaccttaaaatgggccagaaatactccttcagggtt
gctgctgtgaatgcgaagggtatgagtgaatacagcgagtcaactgctgaaattgagccc
gtggaaagactagaaataccagacctagagcttgcagatgatttaaagaagactgtgacc
atcagagctggggcctcattgcgcctgatggtgtctgtatctggaagaccacctcctgtc
atcacatggagcaagaagggcattgaccttgcaaaccgggcaattattgacaccactgac
agctactctttacttattgtggacaaagttaaccggtacgatgctggaaaatacaccatt
gaagccgaaaatcaatctggcaagaaatcagcaacagtccttgttaaagtatacgatact
cctggtccctgtccttcagtgagagttaaagaagtatcgagagattctgtgaccattaca
tgggaagttcccacaattgatggtggcgctcctgtcaacaattacattattgagaaacgt
gaggctgccatgagagcattcaaaacagtaactaccaaatgcagcaagacactgtaccga
atttccggacttgtagaaggaaccatgtactatttcagagtgttgccagaaaacatttac
ggcatcggggaaccctgtgaaacatctgatgcggttctggtctcagaagtacctctggtg
cctacaaagctagaagtggtcgatgtcaccaaatcaactgtcactctggcctgggaaaaa
ccactctacgatggtggtagccgactcactggatatgttcttgaggcctgcaaagctggc
actgagagatggatgaaggtcgtcaccttaaaacccaccgtcctagagcacactgtcatt
tccttaaatgaaggtgaacagtacctgtttagagtaagggcgcaaaatgagaaaggcgta
tcagaaccaagagagatcatcacagccgtgactgtacaagacctcagagtgttgccaaca
atcgatctttctacaatgcctcagaagaccattcatgtcccagccggcagaccagtggag
ctcgtgataccaatcgctggtcgcccacctcctgctgcttcctggttctttgctggttct
aaactaagagaatcagagcgtgtcacagttgaaacgcatactaaagtagctaaattaacc
atccgtgaaaccactatcagagacactggagaatatacacttgaattgaagaatgtaact
ggaactacttcagagaccattaaagttatcattcttgacaagcctggtcctccaactggg
cctattaagattgatgaaattgatgctacttcaattaccatttcctgggaaccacctgaa
ttggatggtggcgctccattgagcggttatgtggtagaacagcgtgatgcccatcgtcca
ggatggctgccagtgtctgaatcagtgactagacagacatttaagtttaccagactcact
gaaggaaatgagtatgtcttccgcgtggctgcgacaaaccgcttcggcattggctcttac
ttgcagtctgaggtcatagaatgtcgcagcagcatcagtattcctggacctccagaaaca
ttacaaatatttgatgtctcccgtgatggcatgacactgacttggtatccaccagaaaac
gatggtggctcccaagtgactggatatattatagagcgcaaagaagtgagagcagatcga
tgggtccgtgtaaataaagtaccagtgacgatgacacggtaccgttccactggccttatt
gaaggcttagaatatgaacaccgtgtcacagccattaatgtgagagggactgggaaacca
agtcgtccttccaaacccatcgttgccatggatccaattgcgcctccaggaaagccacaa
aacccaagagttactgatacaacaaggacatcagtctctctggcctggagtgttccagaa
gatgaaggaggatctaaagtcacaggctacttgattgaaatgcagaaagtagatcaacac
gaatggaccaaatgtaacaccaccccaaccaagattcgggagtataccctaacacatcta
cctcagggtgctgaatacagattccgtgtcctagcctgtaatgctggtggacctggggag
cccgctgaggtaccaggaacagtcaaagtcacggaaatgcttgaatatcctgattatgaa
cttgatgaaagataccaagaaggtatctttgtaagacaaggtggagtcatcagacttacc
ataccaatcaaaggaaaaccattcccaatatgtaaatggactaaggaaggccaagatgtt
agtaagcgcgccatgattgcaacctctgagacacacactgagcttgtaatcaaagaagca
gacagggatgattctggcacttacgacctggttctggaaaacaagtgtggcaagaaggct
gtctacatcaaagtcagggtgataggaaaccccaaccctcctgaagggccccttgaatat
gacgacatacaagctcgctctgtaagggtcagttggagaccccctgccgatgatggtggt
gccgacatcttaggctatattcttgagagacgagaagtgtctaaagccgcctggtataca
attgattccagagtccgaggcacatctctggtggtaaaaggcctcaaagagaatgtggaa
taccatttccgtgtttcagctgaaaaccagtttggcataagcaaacccttgaaatctgaa
gaaccagtcataccaaaaacaccactgaatcctccagagcctccaagcaatcctccagaa
gtactcgatgtgaccaagagttctgtcagcctgtcttggtcccggcccaaagacgatggt
ggttctcgagtcacaggctactacattgaacgcaaggagacttcgactgacaagtgggtc
aggcacaacaagactcagataaccaccacaatgtacactgtcaccgggcttgttcctgat
gcagagtatcagttccgcatcatcgcacagaatgatgttggcctaagtgagaccagccct
gcttctgaaccagttgtttgcaaagatccatttgataagccaagccaacctggagaactt
gagattctttcaatatccaaagatagtgtcactttacagtgggagaaacctgaatgtgat
ggtggcaaagaaatccttggatattgggttgaatacaggcagtctggagacagtgcctgg
aagaagagcaacaaggagcgcatcaaggacaggcaattcacaatagggggtttgctggaa
gccactgaatatgaattcagggtttttgctgagaatgagaccgggcttagcagacctcga
agaactgctatgtctataaagactaaactaacatctggagaggctccaggagtgcgcaaa
gaaatgaaggatgttaccaccaagttgggcgaagctgctcaactctcatgccagattgtt
ggaaggcctcttcctgacattaaatggtaccgatttggtaaggagctggtacaaagccgg
aagtacaaaatgtcttcagacggacgcacacatacgctaacagtaatgacagaggaacaa
gaagatgaaggtgtttatacctgcatagctactaatgaggttggagaagtagaaaccagt
agtaagcttctcctgcaagcaacaccacagttccatcccggttacccactgaaagagaaa
tattatggtgctgtgggttcgacacttcgacttcatgttatgtacattggtcgtccggta
ccttccatcacttggttctatggccagaaacttttgcaaaactcagaaaacattactatt
gaaaacaccgagcactatactcatcttgtcatgaagaatgtccaacgtaagactcacgct
gggaaatacaaagtccagctcagcaatgttcttggaacagttgatgccatccttgatgtg
gacatacaagataaaccagacaaacctacaggaccaattgtgatagaagctctgttgaag
aactctgcagtgatcagctggaaaccacccgcagatgatggaggctcctggatcaccaac
tatgtggtggagaaatgtgaggccaaggaaggggctgaatggcaattggtgtcttcagcc
atctcggtgacaacctgcagaattgtaaacctcacagaaaatgctggctattacttcagg
gtttcagcccagaacacttttggcatcagtgagcctctagaggttgcctcagttgtgatc
attaagagtccttttgaaaagccaggtgctcctggcaaaccaactatcactgctctcaca
aaagattcttgtgttgtggcttggaagccacctgccagtgatggaggtgcaaagattaga
aattactaccttgagaaacgtgagaagaagcagaataaatggattgctgtgacaacagaa
gaaattcgagaaactgtcttttcagtgcaaaaccttattgaaggtcttgaatatgagttc
cgtgtgaaatgtgaaaatctaggtggggaaagtgaatggagtgaaatatcagaacctgcc
actcccaaatctgatgtcccaattcaggcaccacactttaaagaggaactgagaaatcta
aatgtcagatatcagagcaacgctactttggtctgcaaagtaactggtcatccaaaacct
attgtgaaatggtacagacaaggcaaagaaatcattgcagatggactgaagtacaggatt
caagagttcaagggtggctaccaccagctcatcattgcaagtgtcacagacgatgatgcc
acagtttaccaagtcagagctaccaaccaagggggatctgtgtctggcactgcctccttg
gaagtagaagttccagctaagatacacttgcctaaaactcttgaaggcatgggagcagtt
catgctctccgaggtgaggtagtcagcattaagatccctttcagtggcaaaccagatcct
gtgatcacctggcagaaaggacaagatctcatcgacaataatggccactaccaagttatt
gtcacaagatctttcacatcacttgttttccccaatggagtagagagaaaagatgctggt
ttctatgtggtctgtgctaaaaacagatttggaattgatcagaagaccgtcgaactggat
gtggcggatgttcccgacccacccagaggagtcaaagttagtgacgtctcacgagattct
gtcaacttaacatggactgagccagcttctgatggtggcagcaaaatcaccaactacatt
gttgaaaaatgtgcaactactgcagaaagatggctccgtgtaggacaggcccgagaaaca
cgttataccgtggtcaacttatttggaaaaacaagctaccagttccgtgtaatagctgaa
aataaatttggcctgagcaagccttctgagccttcagaaccaaccataaccaaagaagac
aagaccagagccatgaattatgatgaagaggtagacgaaacaagggaagtttccatgact
aaagcatctcactcttcaactaaggaactgtatgagaaatatatgattgctgaagatctt
gggcgtggtcagttcggaattgtccaccgttgtgttgaaacatcctcaaagaagacttac
atggccaaatttgttaaagttaagggaactgatcaggttttggtaaagaaggagatttcc
attctaaacattgccaggcatagaaatatcttatacctccatgaatcatttgagagcatg
gaagaattagttatgatctttgagttcatatcaggacttgacatatttgaacgcattaac
acaagtgcttttgaacttaatgaaagagaaattgtaagttatgttcgccaggtctgcgaa
gcactagagttcttacatagtcataatatcggacacttcgacattagaccagaaaatatc
atttaccaaacaagaaggagctccaccattaaaatcatagaatttggtcaagcccgtcag
ctgaagccaggggacaacttcaggcttctgttcactgcccccgaatactatgcacctgaa
gtccaccagcatgacgttgtcagtaccgccacagacatgtggtcacttggaacactggtg
tatgtgctgttaagtggtaccaatccattcatggctgaaactaaccaacagatgattgag
aacatcatgaatgctgaatatactttcgacgaagaagcattcaaagagattagccttgag
gccatggattttgttgaccggctgttagtgaaagagaaaaaatctcgcatgacagcatcc
gaggcactccggcatccatggctgaagcagaagatagaaagagtcagtactaaagttatc
agaacattaaaacaccggcgttactaccacactctgatcaagaaagacctcaacatggtt
gtgtcggcagcccgaatctcttgtggtggtgcaattcgatctcagaagggagtgagtgtt
gctaaagttaaagtagcatccattgaaattggcccggtttctggacagataatgcatgca
gttggtgaagaaggaggatatgccaaatatgtatgcaaaattgaaaattatgatcagtct
acccaagtgacctggtactttggagtcagacagctggagaacagtgagaaatatgaaatc
acctatgaagatggagtagccaccatgtacatcaaagacattaccaaatttgacgacggc
acctacagatgcaaagtagtcaatgactacggtgaagatagttcttatgcagaactattt
gttaaaggtgtgagagagacttacgactattactgccgtagaaccatgaagaaaattaag
cgcagaactgacacaatgagactcctggaaaggccaccagaatttaccttgcctctctat
aacaagacagcttatgtgggtgaaaatgtccgatttggagtaactataactgtccaccca
gagcctcgtgtaacatggtataaatcaggtcagaaaatcaaaccaggtgatgatgatgcg
aagtacacattcgaatctgacaagggtctttaccagttaacaatcagcagtgtaactata
gatgatgatgctgaatatacggttgtggcaaggaacaaatatggtgaggacagctgcagg
gcgaaactgacagtaaccccacacccaccgccaacagatacaaccttaagacccatgttc
aaacggctgctggcaaacgcagaatgccaagaaggccaaagcgtctgctttgagatcaga
gtgtctggcatccccccaccaaaattaaaatgggagaaagatggccagccactgtccctt
gggcctaacattgaaattatccacgaaggcctggattattatgccttgcacatcagggac
actttgcctgaagacacaggttattatagggtcacagccacgaacacagctggatccacc
agctgccaggctcacctccaagtggaacgcttaaggtacgtcaagcaagaatttaagact
aaggaggagcgtgaacgacacgtccaaaagcaaattgacaagacactaagaatggctgaa
attctttctggaactgaaacggtgccactgacacaggtagcccaagaggctctgagagaa
gctgccattctctacaaaccggctgtaagcaccaagactgtaaaaggggaattccgactt
gagacggaagaaaagaaggaagagagaaaactccgtatgccttatgaggtaccggaacca
cgcaagtacaaacagactaccatagaagaagaccaacgcattaagcaatttgtgcctatg
tccgacatgaaatggtacaaaaagatacgtgatcaatttgaaatgcctgggaaaattgac
agagttgtacagaaaagacccaagcgcattcgcctttcaagatgggaacagttctatgtg
atgcctcttccacgcattacagatcaatacagacctaaatggcgtattcccaaactctcc
caagatgatcttgaaatggtgagaccagcccgccgccgcacaccttctcctgattatgac
ttttattacagaccaagaagacgttctcttggcgacatgtcagacgaagaattactcctt
cccattgatgactacttggcaatgaaaagaacagaggaagagaggctgcgtcttgaagaa
gagcttgagctgggtttctcagcttcaccgccaagccgaagccctccacgttttgagctt
tctagtctgcgttactcttcaccacaagctcacgtcaaggtggaggaaacaagaaaagac
ttcagatattcaacctatcacatccccaccagggctgagactagcacgagctatgcggaa
ctgcgggaacggcacgcccgggcctcctacaggcagccgaaacaacggcagaggatcatg
gctgagaaagaggaggaagagttgcttcgcccagttactaccactcagcgactctcagaa
tacagaagcgagcttgaccacatgtcaaaggaggaaaagtccagaaagaaatcagggcga
cagagagaagtgacagaaataacagaaattgaggaagaatatgaaatctcaaaacacgct
caaagggagtcctcctcctcagtgtccaggctactgcggcggcgacgttccctgtctcca
acctatatcgaattaatgaggcctgtgtccgagctaatccggccacgtcggccgccagag
gaggaatatgaagatgacacagaaagaaggtcccctactccagagagaactcgcccacgt
tcccccagccctgtgtctagtgagagatcactctcaagatttgagaggtctgcaagattt
gatatcttttccaggtatgagtccatgaaagctgctttaaagactcagaagacatcagaa
aggatgtatgaagttttgagtcagcagccttttacgctggaccatgcccctcgaatcaca
ctgagaatgcgctcccacagggcaccatgtggccaaaatacgcgttttatcttaaatgtt
cagtctaagccaaccgctgaggttaaatggtaccacaatggcgtcgaactccaggaaagc
agtaagattcgttacaccaacatgagcggggtattgaccctagaaattctggactgccaa
gctgaggacagcggaacataccgtgccgtgtgcaccaactacaaaggtgaggcctcggac
tacgcgaccttggatgtcacaggcggggattacactacctacgcttcccggcgcagagac
gaacaagtgcctccgtcagttttccctgagctgacaagaacagaggaatacgcagtttcg
tcgtttaagaaaacttctgagatggaagcttcttcttccgtcagggaaatgaagtcacag
atgacagagacaagggaaagtctctcggcctatgaacaccacgcatctgcagaaaagaga
agtgctgccgtagaacagaagtcactggaagaaaaatccacacacagaaagatcaagacg
actttggtgggagcaagaattctgacgaagccaaggtccataactgtgtatgaaggcgag
tccgcgaggttttcttgcgacacagacggtgagccggtacccactgtaacctggctgcgt
ggacgccaagcgataagctcttctgcccgccaccaagtgaccaccacaaagtacaaatca
acctttgagatctcttcggtgcaggcttccgatgagggcaactacagcgtggtggtagaa
aacagcgaaggcaggcaagaagctcagttcactctgactgttcagaaggccagggttact
gaaaaggctgtgacgtcaccaccaagcgtcaaatccccagagcctcgagtgaaatctcca
gaagccgttaagtctccaaaacgagtgaagtccccggaaccagtcactactcacccaaaa
gccgtatcacccacagagacaaaacccacaccaacagagaaagttcagcagctaccagtg
tctgtcccacccaagataactcagtccctgaaagcagaagcatctaaagatattgtgaag
ctgacctgcgcagtcgaaagtagtgtattaagcgcaaaagaggtcacctggtataaagat
ggcaagaaactgaaggaaaatgggcatttccagtttcatttttcagcagatggtacctat
gagctcaaaatccataacctcacggaatccgatagtggagaatacatttgtgagatatct
agcgaaggtggaacttctaaaacgaacttacactttatgggacaagcctttaagagtatc
catgagcaggtgtcaaggataccagaaactaagaaggcagctcagaaaaccgtggagtca
acagaaaccaagaagactgaaccaaaagctccagagccaatttcctcaaaaccaataatc
gtcactgggctgcaggatacaactgtttcttcagacagcgtcgctaagtttgcggtgaaa
gccactggagaaccccggccgaccgtcatctggacaaaggatggaaaggctgttacacaa
ggaagtaaatacaaactctctgaagacaaaggagcttacttcttagaagttcataagact
gatacttctgacagtgggctttatacctgcacagtaacaaactcagctggatctgtgtcc
tctagctgcaaattaactataaaagctgtaaaagatactgaggcacagcaagtgtctaca
caaaagacctctgaaattacgtcacaaaagaaggcggctgtccaagaggaaatttcccaa
aaagccctaatttctgaagaaatgaaactagcagagatgaaatctcaagaacagttagcc
ctcaaggaggaagcctcgaaggttcggatttctgaaaaagtcaagaaatcagaagcaacc
tctctggaaaaatccattgtccatgaggaaatcactaaaacatcacaggcatcggaagaa
atcagaacgcatgcagagattaaagcattttctactcagatgagcataactgatggtcag
aaagtgaccttaaaagccaacattgctggtgccactgatgtgaaatgggtactgaatggc
gtagagctcgctaactctgaggagtacagatacggtgtctcgggcagcgatcagaccctg
accatcaagcaggccagtcacaaagacgaagggatcctcacctgcataggcaaaaccagc
caagggatcattaaatgtcagtatgatctgatgctgagcaaagaactctcagatgctcca
gccttcatctcccagcccagatctcaaaatattaacgagggacaaaatgttgtcttttct
tgtgaaatcagtggtgagccatccccggaaatcgaatggtttaaaaacaacttgccgatt
tctgtttcttcaaatatcagtgtaagtcgctccagaaatgtatattctcttgaaatccga
aatgcatcagtaagcgacagtggaaagtacacagttaaggccaaaaatttccgtggccag
tgttcagctactgcttccttaacggtccttcctctagttgaagaacctcccagagaggta
gtattgaggacaagtggtgacacaagcttgcaaggaagcttctcgtctcagtcagtccaa
atgtctgcctccaagcaggaggcgtccttcagcagtttcagcagcagcagtgctagcagc
atgactgaaatgaaatttgcaagcatgtctgcccaaagcatgtcctccatgcaagagtcc
tttgtagaaatgagttccagcagttttatgggaaaatctagtatgacacaactggaaagc
tcaactagtagaatgcttaaagcaggcgtaagaggaattccacctaaaattgaagcgctt
ccctctgacatcagcattgatgagggcaaagttttaacagtagcctgtgcttttacgggt
gagcctaccccggaaataatatggtcccgtggcggaagaaaaattcaaaaccaagaacaa
cacgggcgattccacattgaaaacacagatgacctgacaactctcatcatcatggacgta
cagaaacaagatggtggactttataccctgagcttagggaatgaatttggatctgactct
gccactgtgaatataaatattcgatccatgtaa

DBGET integrated database retrieval system