KEGG   Ursus arctos horribilis: 113253267Help
Entry
113253267         CDS       T05909                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
uah  Ursus arctos horribilis
Pathway
uah04022  cGMP-PKG signaling pathway
uah04024  cAMP signaling pathway
uah04062  Chemokine signaling pathway
uah04071  Sphingolipid signaling pathway
uah04270  Vascular smooth muscle contraction
uah04350  TGF-beta signaling pathway
uah04360  Axon guidance
uah04510  Focal adhesion
uah04530  Tight junction
uah04611  Platelet activation
uah04670  Leukocyte transendothelial migration
uah04810  Regulation of actin cytoskeleton
uah04921  Oxytocin signaling pathway
uah05132  Salmonella infection
uah05135  Yersinia infection
uah05163  Human cytomegalovirus infection
uah05200  Pathways in cancer
uah05205  Proteoglycans in cancer
uah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:uah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    113253267 (ROCK1)
   04071 Sphingolipid signaling pathway
    113253267 (ROCK1)
   04024 cAMP signaling pathway
    113253267 (ROCK1)
   04022 cGMP-PKG signaling pathway
    113253267 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113253267 (ROCK1)
   04530 Tight junction
    113253267 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113253267 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    113253267 (ROCK1)
   04670 Leukocyte transendothelial migration
    113253267 (ROCK1)
   04062 Chemokine signaling pathway
    113253267 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    113253267 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113253267 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    113253267 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113253267 (ROCK1)
   05206 MicroRNAs in cancer
    113253267 (ROCK1)
   05205 Proteoglycans in cancer
    113253267 (ROCK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113253267 (ROCK1)
   05135 Yersinia infection
    113253267 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    113253267 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:uah01001]
    113253267 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:uah03036]
    113253267 (ROCK1)
Enzymes [BR:uah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113253267 (ROCK1)
Protein kinases [BR:uah01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   113253267 (ROCK1)
Chromosome and associated proteins [BR:uah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    113253267 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 HR1 APH Pkinase_C
Motif
Other DBs
NCBI-GeneID: 113253267
NCBI-ProteinID: XP_026351847
UniProt: A0A3Q7WMW5
Position
Unknown
AA seq 1355 aa AA seqDB search
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRSSPNV
DKSLQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLASEKL
AQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKTQTD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLSLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNREYLKKIQELQSEKETLATQLDLAETKAE
SEQLARGLLEEQYFELSQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIELLRKENE
ELTDKMRRAEEEYKLKKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHKNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSIPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSAANQSFRKVVKNTSGKTSS
NT seq 4068 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcagattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaattagagatttacgaatgaaagcagaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtatatgctatgaagcttctcagtaaatttgaaatgattaagagatccgattctgctttt
ttttgggaagaaagggacatcatggcttttgctaacagcccttgggtcgtccagcttttt
tatgcattccaagatgatcgttatctctacatggtgatggagtacatgcctggcggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcacgattctatactgca
gaagtagttcttgcattggatgcaatccattccatgggtttcattcatagagatgtgaaa
cctgataacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggtatggtacgatgtgatacagcagttggaacacctgattac
atttctcctgaagtattaaaatctcaaggtggtgatggctattatggacgagaatgtgac
tggtggtcagttggggtatttttatatgaaatgcttgtaggtgatacacctttttatgca
gattctctggttggaacttacagtaagattatgaaccataaaaattcacttactttccct
gatgataatgatatatcaaaagaagcaaaaaatcttatttgtgccttccttactgacaga
gaggtgagattagggcgaaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gatcaatgggcttgggaaacactcagagacactgtagcaccagttgtacctgatttaagt
agtgacattgatacaagtaattttgatgacttggaagaagataaaggagatgaagaaaca
ttccccatacctaaagcttttgttggcaatcaattaccttttgtaggatttacatattat
agcaatcgtagatacttatcttcagcaaatcctaatgataaccgaagtagccccaatgtg
gataaaagcttgcaggaaaatttgcaaaaaacaatttataagctggaagaacagctgcat
aatgaaatgcaattaaaagatgaaatggagcagaagtgcagaacttcaaacataaaacta
gacaagataatgaaagaattggatgaagaggggaatcaaagaagaaacctagaatctaca
gtgtctcagattgagaaggagaaaatgttgctacagcatagaattaatgagtaccagaga
aaagcagaacaggaaaatgagaagaggaggaatgtagaaaatgaagtttctacattaaag
gatcagttggaagacttgaagaaagtaagtcaaaattcacagcttgctagtgagaagctg
gcgcaattacaaaagcagctagaagaagccaatgacttacttaggacagaatcagacaca
gccgtaagattaaggaagagtcacacagagatgagtaagtcaattagtcagctagagtcc
ctaaacagagaattgcaggagagaaatagaattttagagaattccaagacacagacggac
aaggactattaccagctgcaagctgtattagaagctgaacgaagagacagaggtcatgat
tctgagatgattggagaccttcaagctcgaattacatctttacaagaggaggtgaagcat
ctcaaacataatcttgaaagagtggaaggagaaagaaaagaagctcaagacatgcttaat
cactcagaaaaggaaaaaaataatttagagatagatttgaactataagcttaaatcatta
caacaacgtttagaacaagaggtaaatgaacataaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaggcaaagtctgttgcaatgtgtgaaatggaaaaaaagctg
aaggaagagagagaagctcgagagaaggctgaaaatagagttgttcagattgagaagcag
tgttcaatgctagatgttgatctgaaacagtctcagcagaagctcgagcatttgactgaa
aataaagaaaggatggaggatgaagttaagaatctatcccttcaactggagcaggaatca
aacaagcgactgttgttacagaatgaattgaagactcaggcatttgaagcagacaattta
aaaggtctagaaaagcagatgaaacaagaaataaatactttattggaagcaaagagatta
ttagaatttgaattagctcagcttacaaaacagtatagaggaaatgaaggacagatgagg
gagctacaagatcagcttgaagctgagcagtatttctcgacactttataaaacccaggta
aaggaacttaaggaagaaattgaagaaaaaaacagagaatatttaaagaaaatacaagag
ttacaaagtgaaaaagaaactcttgctactcagttggatctagcagaaacaaaagctgag
tctgagcaattggctcgagggcttctggaagaacagtattttgaattaagccaagaaagc
aagaaagctgcttccagaaataggcaagagattacagataaagatcatactgttagtcgg
cttgaagaagcaaacagcatgttaaccaaagatattgaattattaagaaaagaaaatgaa
gagctaactgataaaatgaggagggcagaggaagaatataaattgaagaaggaggaggag
attagtaatcttaaggctgcctttgaaaagaatatcaatacagaaagaacccttaaaaca
caggctgttaacaagttggcagaaataatgaatcggaaagattttaaaattgatagaaag
aaagctaatacacaggatttgagaaagaaagaaaaggaaaatcgaaagctgcaactggaa
ctcaaccaagaaagagagaaattcaaccagatggtagtgaaacatcagaaggaactgaat
gacatgcaagcgcaattggtagaagaatgtacacataagaatgagcttcagatgcaattg
gctagcaaagagagtgatattgagcaattgcgtgctaaacttttggacctttcggattct
acaagtgttgctagttttcctagtgctgatgaaactgatggaaaccttccagagtcaaga
attgaaggttggctttcaataccaaatagaggaaatatcaaacgatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaaaattttgttctataatgatgaacaagataaggaa
caatccaatccatccatggtattggacatagataaactgtttcacgttcgaccagtaact
caaggagatgtttacagagctgaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggcgaatgtagaaaagatgtagagatggaaccagtacaacaagctgaaaag
actaattttcaaaaccacaaaggccatgagttcattcctacactctaccactttcctgcc
aactgtgaggcctgtgccaaacctctctggcatgtttttaagccacctcctgccctagaa
tgtcgaagatgccatgttaagtgccacagagatcacttagataagaaagaggacttaatt
tctccatgtaaagtaagttatgatgtaacatcagcaagagatatgctgctgttagcgtgt
tctcaggatgaacaaaaaaagtgggtaacacatttggtaaagaagatccctaagaatcca
ccttctggttttgttcgtgcatcccctcgaacgctttctacaagatctgctgcaaatcag
tctttccgaaaagtggtcaaaaatacatctggaaaaactagcagttaa

DBGET integrated database retrieval system