KEGG   Ursus arctos horribilis: 113253657Help
Entry
113253657         CDS       T05909                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
uah  Ursus arctos horribilis
Pathway
uah00120  Primary bile acid biosynthesis
uah01100  Metabolic pathways
uah03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:uah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    113253657
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    113253657
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:uah00199]
    113253657
Enzymes [BR:uah01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     113253657
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     113253657
Cytochrome P450 [BR:uah00199]
 Cytochrome P450, animal type
  CYP8 family
   113253657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 113253657
NCBI-ProteinID: XP_026352370
UniProt: A0A3Q7VJN6
Position
Unknown
AA seq 501 aa AA seqDB search
MVLWGLVLGALLVVTMGCLCLLGLLRQRRPQEPPLDKGSIPWLGHAVAFRKNMFEFLKHM
RAKHGDVFTVQLGGQYFTFVMDPLSFGPILKDAQRKLDFVEYAEKLVLKVFGYQSVQGDY
RMIHSASTKYLMGDGLKDLNKTMLDSLALVLLGPTGQSLDSSRWHEDGLFHFCYSVLFKA
GYLSLFGYTKDEGQDLRQAEELFAQFRKFDRLFPRFVYSLLGPREWLEVGRLQSLFHKTL
SVRHNLEKNGISNWISYMLHYLREQGVDPAMQDKFNFMMLWASQGNTGPASFWALLFLLK
HPEAMRAVREEATQVLAEARLKARQSFDFDVSVLQRTPVLDSVMEETLRLGAAPTLLRVV
HSDHVLKMANGQEYLLRSRDIVALFPYLSVHMDPDIHPEPTAFKYDRFLNPNGSRKVDFY
KAGKKIHHYTMPWGSGVSICPGRFLAISEMKLFILLMVTHFDLELVDPATPVPPVDPHRW
GFGTTQPSHEVRFRYRLRPTN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtcctctggggtctggtgctgggagccctgctggtggtcaccatggggtgcctgtgt
ctgctggggctgctccggcaacgcaggccccaggagccccctctggataagggctccata
ccctggctgggccatgctgtggctttccggaagaatatgtttgaattcctgaagcacatg
cgggccaagcatggagatgtgttcacagtgcagctagggggccagtactttacctttgtc
atggaccccctctcctttggccccatcctcaaggatgcacagagaaaactagacttcgtg
gagtatgcagaaaaactggtgctaaaggtatttggataccagtcagtgcaaggagactac
cggatgatacactctgccagcaccaagtacctcatgggggatggcttgaaggatctcaac
aaaaccatgctggacagcctggccctggttctgctggggcccacgggccagagtctggat
tctagccgctggcatgaagatggcctcttccacttctgctacagcgtcttgttcaaggct
ggctacctgagcttatttggctacacgaaggacgaggggcaagacctgcggcaggcagag
gagttatttgcccagttccgcaagtttgaccgcttgttccccaggtttgtgtactccctg
ctggggccccgggagtggctagaagtgggccggctccagagtctcttccataagacactc
tctgtgcggcacaacttggaaaagaatggcatcagcaactggatatcctacatgcttcac
tatctgagggagcagggagtagacccagccatgcaggacaagttcaacttcatgatgctc
tgggcctcccaggggaacacgggcccggcctctttctgggccctcttgttcctgctcaag
cacccagaagccatgcgggctgtgagggaggaggccacccaagtcctggcagaggcgagg
ctgaaggccaggcagtcctttgactttgacgtcagtgtgctgcagcgcactccggtgctg
gacagtgtgatggaggagacgctgcggctgggggctgcacccaccctcctccgagtggta
cacagcgaccatgtcctgaagatggccaatggacaggagtacctgctccgaagcagagac
attgtggccctctttccctatctttcagtgcacatggatcctgacatccacccggaaccc
acggccttcaagtatgatcgcttcctcaaccccaatggtagccggaaagtggacttctac
aaggccggcaagaagatccaccactacaccatgccgtggggctcaggtgtctccatctgc
cctgggaggtttctggccatcagtgagatgaagctcttcatcctgctcatggtcacacac
tttgacctggagctggtagaccccgccacacctgtgccacccgtggacccccaccgctgg
ggctttggcaccacccagcccagccacgaggtgcgcttccgttaccgcctgcgacctact
aactga

DBGET integrated database retrieval system